KEGG   Homo sapiens (human): 2263Help
Entry
2263              CDS       T01001                                 

Gene name
FGFR2, BBDS, BEK, BFR-1, CD332, CEK3, CFD1, ECT1, JWS, K-SAM, KGFR, TK14, TK25
Definition
(RefSeq) fibroblast growth factor receptor 2
  KO
K05093  fibroblast growth factor receptor 2 [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04144  Endocytosis
hsa04151  PI3K-Akt signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04810  Regulation of actin cytoskeleton
hsa05200  Pathways in cancer
hsa05215  Prostate cancer
hsa05226  Gastric cancer
hsa05230  Central carbon metabolism in cancer
Network
N00019  FGF-FGFR-RAS-ERK signaling pathway
N00020  Amplified FGFR to RAS-ERK signaling pathway
N00037  FGF-FGFR-PI3K signaling pathway
N00038  Amplified FGFR to PI3K signaling pathway
Disease
H00018  Gastric cancer
H00458  Craniosynostosis
H00642  Lacrimo-auriculo-dento-digital syndrome (LADD)
H01753  Antley-Bixler syndrome
H01754  Crouzon syndrome
H01755  Apert syndrome
H01756  Pfeiffer syndrome
H01988  Jackson-Weiss syndrome
H01989  Beare-Stevenson syndrome
H01991  Saethre-Chotzen syndrome
Drug target
Erdafitinib: D10927
Lenvatinib (DG01362): D09919 D09920
Nintedanib (DG01374): D10396 D10481
Palifermin: D05338
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    2263 (FGFR2)
   04015 Rap1 signaling pathway
    2263 (FGFR2)
   04010 MAPK signaling pathway
    2263 (FGFR2)
   04151 PI3K-Akt signaling pathway
    2263 (FGFR2)
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    2263 (FGFR2)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    2263 (FGFR2)
  Cell motility
   04810 Regulation of actin cytoskeleton
    2263 (FGFR2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    2263 (FGFR2)
   05230 Central carbon metabolism in cancer
    2263 (FGFR2)
   05226 Gastric cancer
    2263 (FGFR2)
   05215 Prostate cancer
    2263 (FGFR2)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    2263 (FGFR2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     2263 (FGFR2)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  FGFR family [OT]
   2263 (FGFR2)
CD molecules [BR:hsa04090]
 Proteins
  2263 (FGFR2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Growth factors/receptors (General comment) Ligand-receptor clustering and signaling, cell migration, mitogenesis
   2263 (FGFR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase I-set Ig_3 Ig_2 ig V-set Ig_5 C2-set_2 Kinase-like
Motif
Other DBs
NCBI-GeneID: 2263
NCBI-ProteinID: NP_000132
OMIM: 176943
HGNC: 3689
Ensembl: ENSG00000066468
Vega: OTTHUMG00000019175
Pharos: P21802(Tclin)
UniProt: P21802
LinkDB All DBs
Structure
PDB: 

Position
10q26.13
AA seq 821 aa AA seqDB search
MVSWGRFICLVVVTMATLSLARPSFSLVEDTTLEPEEPPTKYQISQPEVYVAAPGESLEV
RCLLKDAAVISWTKDGVHLGPNNRTVLIGEYLQIKGATPRDSGLYACTASRTVDSETWYF
MVNVTDAISSGDDEDDTDGAEDFVSENSNNKRAPYWTNTEKMEKRLHAVPAANTVKFRCP
AGGNPMPTMRWLKNGKEFKQEHRIGGYKVRNQHWSLIMESVVPSDKGNYTCVVENEYGSI
NHTYHLDVVERSPHRPILQAGLPANASTVVGGDVEFVCKVYSDAQPHIQWIKHVEKNGSK
YGPDGLPYLKVLKAAGVNTTDKEIEVLYIRNVTFEDAGEYTCLAGNSIGISFHSAWLTVL
PAPGREKEITASPDYLEIAIYCIGVFLIACMVVTVILCRMKNTTKKPDFSSQPAVHKLTK
RIPLRRQVTVSAESSSSMNSNTPLVRITTRLSSTADTPMLAGVSEYELPEDPKWEFPRDK
LTLGKPLGEGCFGQVVMAEAVGIDKDKPKEAVTVAVKMLKDDATEKDLSDLVSEMEMMKM
IGKHKNIINLLGACTQDGPLYVIVEYASKGNLREYLRARRPPGMEYSYDINRVPEEQMTF
KDLVSCTYQLARGMEYLASQKCIHRDLAARNVLVTENNVMKIADFGLARDINNIDYYKKT
TNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLMWEIFTLGGSPYPGIPVEELFKLLKEGH
RMDKPANCTNELYMMMRDCWHAVPSQRPTFKQLVEDLDRILTLTTNEEYLDLSQPLEQYS
PSYPDTRSSCSSGDDSVFSPDPMPYEPCLPQYPHINGSVKT
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atggtcagctggggtcgtttcatctgcctggtcgtggtcaccatggcaaccttgtccctg
gcccggccctccttcagtttagttgaggataccacattagagccagaagagccaccaacc
aaataccaaatctctcaaccagaagtgtacgtggctgcgccaggggagtcgctagaggtg
cgctgcctgttgaaagatgccgccgtgatcagttggactaaggatggggtgcacttgggg
cccaacaataggacagtgcttattggggagtacttgcagataaagggcgccacgcctaga
gactccggcctctatgcttgtactgccagtaggactgtagacagtgaaacttggtacttc
atggtgaatgtcacagatgccatctcatccggagatgatgaggatgacaccgatggtgcg
gaagattttgtcagtgagaacagtaacaacaagagagcaccatactggaccaacacagaa
aagatggaaaagcggctccatgctgtgcctgcggccaacactgtcaagtttcgctgccca
gccggggggaacccaatgccaaccatgcggtggctgaaaaacgggaaggagtttaagcag
gagcatcgcattggaggctacaaggtacgaaaccagcactggagcctcattatggaaagt
gtggtcccatctgacaagggaaattatacctgtgtagtggagaatgaatacgggtccatc
aatcacacgtaccacctggatgttgtggagcgatcgcctcaccggcccatcctccaagcc
ggactgccggcaaatgcctccacagtggtcggaggagacgtagagtttgtctgcaaggtt
tacagtgatgcccagccccacatccagtggatcaagcacgtggaaaagaacggcagtaaa
tacgggcccgacgggctgccctacctcaaggttctcaaggccgccggtgttaacaccacg
gacaaagagattgaggttctctatattcggaatgtaacttttgaggacgctggggaatat
acgtgcttggcgggtaattctattgggatatcctttcactctgcatggttgacagttctg
ccagcgcctggaagagaaaaggagattacagcttccccagactacctggagatagccatt
tactgcataggggtcttcttaatcgcctgtatggtggtaacagtcatcctgtgccgaatg
aagaacacgaccaagaagccagacttcagcagccagccggctgtgcacaagctgaccaaa
cgtatccccctgcggagacaggtaacagtttcggctgagtccagctcctccatgaactcc
aacaccccgctggtgaggataacaacacgcctctcttcaacggcagacacccccatgctg
gcaggggtctccgagtatgaacttccagaggacccaaaatgggagtttccaagagataag
ctgacactgggcaagcccctgggagaaggttgctttgggcaagtggtcatggcggaagca
gtgggaattgacaaagacaagcccaaggaggcggtcaccgtggccgtgaagatgttgaaa
gatgatgccacagagaaagacctttctgatctggtgtcagagatggagatgatgaagatg
attgggaaacacaagaatatcataaatcttcttggagcctgcacacaggatgggcctctc
tatgtcatagttgagtatgcctctaaaggcaacctccgagaatacctccgagcccggagg
ccacccgggatggagtactcctatgacattaaccgtgttcctgaggagcagatgaccttc
aaggacttggtgtcatgcacctaccagctggccagaggcatggagtacttggcttcccaa
aaatgtattcatcgagatttagcagccagaaatgttttggtaacagaaaacaatgtgatg
aaaatagcagactttggactcgccagagatatcaacaatatagactattacaaaaagacc
accaatgggcggcttccagtcaagtggatggctccagaagccctgtttgatagagtatac
actcatcagagtgatgtctggtccttcggggtgttaatgtgggagatcttcactttaggg
ggctcgccctacccagggattcccgtggaggaactttttaagctgctgaaggaaggacac
agaatggataagccagccaactgcaccaacgaactgtacatgatgatgagggactgttgg
catgcagtgccctcccagagaccaacgttcaagcagttggtagaagacttggatcgaatt
ctcactctcacaaccaatgaggaatacttggacctcagccaacctctcgaacagtattca
cctagttaccctgacacaagaagttcttgttcttcaggagatgattctgttttttctcca
gaccccatgccttacgaaccatgccttcctcagtatccacacataaacggcagtgttaaa
acatga

DBGET integrated database retrieval system