KEGG   Homo sapiens (human): 2268Help
Entry
2268              CDS       T01001                                 

Gene name
FGR, SRC2, c-fgr, c-src2, p55-Fgr, p55c-fgr, p58-Fgr, p58c-fgr
Definition
(RefSeq) FGR proto-oncogene, Src family tyrosine kinase
  KO
K08891  tyrosine-protein kinase Fgr [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2268 (FGR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2268 (FGR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2268 (FGR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2268 (FGR)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   2268 (FGR)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    2268 (FGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 zf-RING_14 Kdo
Motif
Other DBs
NCBI-GeneID: 2268
NCBI-ProteinID: NP_001036194
OMIM: 164940
HGNC: 3697
Ensembl: ENSG00000000938
Vega: OTTHUMG00000003516
Pharos: P09769(Tchem)
UniProt: P09769 P78453
LinkDB All DBs
Position
1p35.3
AA seq 529 aa AA seqDB search
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgttctgcaagaaattggagccggtggccacggccaaggaggatgctggc
ctggaaggggacttcagaagctacggggcagcagaccactatgggcctgaccccactaag
gcccggcctgcatcctcatttgcccacatccccaactacagcaacttctcctctcaggcc
atcaaccctggcttccttgatagtggcaccatcaggggtgtgtcagggattggggtgacc
ctgttcattgccctgtatgactatgaggctcgaactgaggatgacctcaccttcaccaag
ggcgagaagttccacatcctgaacaatactgaaggtgactggtgggaggctcggtctctc
agctccggaaaaactggctgcattcccagcaactacgtggcccctgttgactcaatccaa
gctgaagagtggtactttggaaagattgggagaaaggatgcagagaggcagctgctttca
ccaggcaacccccagggggcctttctcattcgggaaagcgagaccaccaaaggtgcctac
tccctgtccatccgggactgggatcagaccagaggcgatcatgtgaagcattacaagatc
cgcaaactggacatgggcggctactacatcaccacacgggttcagttcaactcggtgcag
gagctggtgcagcactacatggaggtgaatgacgggctgtgcaacctgctcatcgcgccc
tgcaccatcatgaagccgcagacgctgggcctggccaaggacgcctgggagatcagccgc
agctccatcacgctggagcgccggctgggcaccggctgcttcggggatgtgtggctgggc
acgtggaacggcagcactaaggtggcggtgaagacgctgaagccgggcaccatgtccccg
aaggccttcctggaggaggcgcaggtcatgaagctgctgcggcacgacaagctggtgcag
ctgtacgccgtggtgtcggaggagcccatctacatcgtgaccgagttcatgtgtcacggc
agcttgctggattttctcaagaacccagagggccaggatttgaggctgccccaattggtg
gacatggcagcccaggtagctgagggcatggcctacatggaacgcatgaactacattcac
cgcgacctgagggcagccaacatcctggttggggagcggctggcgtgcaagatcgcagac
tttggcttggcgcgtctcatcaaggacgatgagtacaacccctgccaaggttccaagttc
cccatcaagtggacagccccagaagctgccctctttggcagattcaccatcaagtcagac
gtgtggtcctttgggatcctgctcactgagctcatcaccaagggccgaatcccctaccca
ggcatgaataaacgggaagtgttggaacaggtggagcagggctaccacatgccgtgccct
ccaggctgcccagcatccctgtacgaggccatggaacagacctggcgtctggacccggag
gagaggcctaccttcgagtacctgcagtccttcctggaggactacttcacctccgctgaa
ccacagtaccagcccggggatcagacatag

DBGET integrated database retrieval system