KEGG   Homo sapiens (human): 2268Help
Entry
2268              CDS       T01001                                 

Gene name
FGR, SRC2, c-fgr, c-src2, p55-Fgr, p55c-fgr, p58-Fgr, p58c-fgr
Definition
(RefSeq) FGR proto-oncogene, Src family tyrosine kinase
  KO
K08891  tyrosine-protein kinase Fgr [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2268 (FGR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2268 (FGR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2268 (FGR)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2268 (FGR)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   2268 (FGR)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    2268 (FGR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 zf-RING_14 Kdo
Motif
Other DBs
NCBI-GeneID: 2268
NCBI-ProteinID: NP_001036194
OMIM: 164940
HGNC: 3697
Ensembl: ENSG00000000938
Vega: OTTHUMG00000003516
Pharos: P09769(Tchem)
UniProt: P09769 P78453
LinkDB All DBs
Position
1p35.3
AA seq 529 aa AA seqDB search
MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQA
INPGFLDSGTIRGVSGIGVTLFIALYDYEARTEDDLTFTKGEKFHILNNTEGDWWEARSL
SSGKTGCIPSNYVAPVDSIQAEEWYFGKIGRKDAERQLLSPGNPQGAFLIRESETTKGAY
SLSIRDWDQTRGDHVKHYKIRKLDMGGYYITTRVQFNSVQELVQHYMEVNDGLCNLLIAP
CTIMKPQTLGLAKDAWEISRSSITLERRLGTGCFGDVWLGTWNGSTKVAVKTLKPGTMSP
KAFLEEAQVMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLDFLKNPEGQDLRLPQLV
DMAAQVAEGMAYMERMNYIHRDLRAANILVGERLACKIADFGLARLIKDDEYNPCQGSKF
PIKWTAPEAALFGRFTIKSDVWSFGILLTELITKGRIPYPGMNKREVLEQVEQGYHMPCP
PGCPASLYEAMEQTWRLDPEERPTFEYLQSFLEDYFTSAEPQYQPGDQT
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgttctgcaagaaattggagccggtggccacggccaaggaggatgctggc
ctggaaggggacttcagaagctacggggcagcagaccactatgggcctgaccccactaag
gcccggcctgcatcctcatttgcccacatccccaactacagcaacttctcctctcaggcc
atcaaccctggcttccttgatagtggcaccatcaggggtgtgtcagggattggggtgacc
ctgttcattgccctgtatgactatgaggctcgaactgaggatgacctcaccttcaccaag
ggcgagaagttccacatcctgaacaatactgaaggtgactggtgggaggctcggtctctc
agctccggaaaaactggctgcattcccagcaactacgtggcccctgttgactcaatccaa
gctgaagagtggtactttggaaagattgggagaaaggatgcagagaggcagctgctttca
ccaggcaacccccagggggcctttctcattcgggaaagcgagaccaccaaaggtgcctac
tccctgtccatccgggactgggatcagaccagaggcgatcatgtgaagcattacaagatc
cgcaaactggacatgggcggctactacatcaccacacgggttcagttcaactcggtgcag
gagctggtgcagcactacatggaggtgaatgacgggctgtgcaacctgctcatcgcgccc
tgcaccatcatgaagccgcagacgctgggcctggccaaggacgcctgggagatcagccgc
agctccatcacgctggagcgccggctgggcaccggctgcttcggggatgtgtggctgggc
acgtggaacggcagcactaaggtggcggtgaagacgctgaagccgggcaccatgtccccg
aaggccttcctggaggaggcgcaggtcatgaagctgctgcggcacgacaagctggtgcag
ctgtacgccgtggtgtcggaggagcccatctacatcgtgaccgagttcatgtgtcacggc
agcttgctggattttctcaagaacccagagggccaggatttgaggctgccccaattggtg
gacatggcagcccaggtagctgagggcatggcctacatggaacgcatgaactacattcac
cgcgacctgagggcagccaacatcctggttggggagcggctggcgtgcaagatcgcagac
tttggcttggcgcgtctcatcaaggacgatgagtacaacccctgccaaggttccaagttc
cccatcaagtggacagccccagaagctgccctctttggcagattcaccatcaagtcagac
gtgtggtcctttgggatcctgctcactgagctcatcaccaagggccgaatcccctaccca
ggcatgaataaacgggaagtgttggaacaggtggagcagggctaccacatgccgtgccct
ccaggctgcccagcatccctgtacgaggccatggaacagacctggcgtctggacccggag
gagaggcctaccttcgagtacctgcagtccttcctggaggactacttcacctccgctgaa
ccacagtaccagcccggggatcagacatag

KEGG   Homo sapiens (human): 3055Help
Entry
3055              CDS       T01001                                 

Gene name
HCK, JTK9, p59Hck, p61Hck
Definition
(RefSeq) HCK proto-oncogene, Src family tyrosine kinase
  KO
K08893  hemopoietic cell kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    3055 (HCK)
   04062 Chemokine signaling pathway
    3055 (HCK)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    3055 (HCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3055 (HCK)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    3055 (HCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3055 (HCK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   3055 (HCK)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    3055 (HCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 3055
NCBI-ProteinID: NP_002101
OMIM: 142370
HGNC: 4840
Ensembl: ENSG00000101336
Vega: OTTHUMG00000032204
Pharos: P08631(Tclin)
UniProt: P08631 F6SF04
LinkDB All DBs
Structure
PDB: 

Position
20q11.21
AA seq 526 aa AA seqDB search
MGGRSSCEDPGCPRDEERAPRMGCMKSKFLQVGGNTFSKTETSASPHCPVYVPDPTSTIK
PGPNSHNSNTPGIREAGSEDIIVVALYDYEAIHHEDLSFQKGDQMVVLEESGEWWKARSL
ATRKEGYIPSNYVARVDSLETEEWFFKGISRKDAERQLLAPGNMLGSFMIRDSETTKGSY
SLSVRDYDPRQGDTVKHYKIRTLDNGGFYISPRSTFSTLQELVDHYKKGNDGLCQKLSVP
CMSSKPQKPWEKDAWEIPRESLKLEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVE
AFLAEANVMKTLQHDKLVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLID
FSAQIAEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARVIEDNEYTAREGAKFP
IKWTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALERGYRMPRPE
NCPEELYNIMMRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
ctgggggggcgctcaagctgcgaggatccgggctgcccgcgagacgaggagcgggcgccc
aggatggggtgcatgaagtccaagttcctccaggtcggaggcaatacattctcaaaaact
gaaaccagcgccagcccacactgtcctgtgtacgtgccggatcccacatccaccatcaag
ccggggcctaatagccacaacagcaacacaccaggaatcagggaggcaggctctgaggac
atcatcgtggttgccctgtatgattacgaggccattcaccacgaagacctcagcttccag
aagggggaccagatggtggtcctagaggaatccggggagtggtggaaggctcgatccctg
gccacccggaaggagggctacatcccaagcaactatgtcgcccgcgttgactctctggag
acagaggagtggtttttcaagggcatcagccggaaggacgcagagcgccaactgctggct
cccggcaacatgctgggctccttcatgatccgggatagcgagaccactaaaggaagctac
tctttgtccgtgcgagactacgaccctcggcagggagataccgtgaaacattacaagatc
cggaccctggacaacgggggcttctacatatccccccgaagcaccttcagcactctgcag
gagctggtggaccactacaagaaggggaacgacgggctctgccagaaactgtcggtgccc
tgcatgtcttccaagccccagaagccttgggagaaagatgcctgggagatccctcgggaa
tccctcaagctggagaagaaacttggagctgggcagtttggggaagtctggatggccacc
tacaacaagcacaccaaggtggcagtgaagacgatgaagccagggagcatgtcggtggag
gccttcctggcagaggccaacgtgatgaaaactctgcagcatgacaagctggtcaaactt
catgcggtggtcaccaaggagcccatctacatcatcacggagttcatggccaaaggaagc
ttgctggactttctgaaaagtgatgagggcagcaagcagccattgccaaaactcattgac
ttctcagcccagattgcagaaggcatggccttcatcgagcagaggaactacatccaccga
gacctccgagctgccaacatcttggtctctgcatccctggtgtgtaagattgctgacttt
ggcctggcccgggtcattgaggacaacgagtacacggctcgggaaggggccaagttcccc
atcaagtggacagctcctgaagccatcaactttggctccttcaccatcaagtcagacgtc
tggtcctttggtatcctgctgatggagatcgtcacctacggccggatcccttacccaggg
atgtcaaaccctgaagtgatccgagctctggagcgtggataccggatgcctcgcccagag
aactgcccagaggagctctacaacatcatgatgcgctgctggaaaaaccgtccggaggag
cggccgaccttcgaatacatccagagtgtgctggatgacttctacacggccacagagagc
cagtaccaacagcagccatga

KEGG   Homo sapiens (human): 4067Help
Entry
4067              CDS       T01001                                 

Gene name
LYN, JTK8, p53Lyn, p56Lyn
Definition
(RefSeq) LYN proto-oncogene, Src family tyrosine kinase
  KO
K05854  tyrosine-protein kinase Lyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04062  Chemokine signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04611  Platelet activation
hsa04662  B cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04666  Fc gamma R-mediated phagocytosis
hsa04730  Long-term depression
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06114  PI3K signaling (virus)
nt06120  Calcium signaling (virus)
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
nt06165  Epstein-Barr virus (EBV)
nt06220  Calcium signaling
  Element
N00266  EBV LMP2A to PI3K signaling pathway
N00487  BCR-PLCG-Calcineurin signaling pathway
N00488  EBV LMP2A to BCR signaling pathway
Drug target
Bafetinib: D10202
Tolimidone: D06182
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    4067 (LYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    4067 (LYN)
   04662 B cell receptor signaling pathway
    4067 (LYN)
   04664 Fc epsilon RI signaling pathway
    4067 (LYN)
   04666 Fc gamma R-mediated phagocytosis
    4067 (LYN)
   04062 Chemokine signaling pathway
    4067 (LYN)
  09156 Nervous system
   04730 Long-term depression
    4067 (LYN)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    4067 (LYN)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    4067 (LYN)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    4067 (LYN)
   05169 Epstein-Barr virus infection
    4067 (LYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    4067 (LYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    4067 (LYN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     4067 (LYN)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   4067 (LYN)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    4067 (LYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3
Motif
Other DBs
NCBI-GeneID: 4067
NCBI-ProteinID: NP_002341
OMIM: 165120
HGNC: 6735
Ensembl: ENSG00000254087
Vega: OTTHUMG00000044345
Pharos: P07948(Tclin)
UniProt: P07948 Q6NUK7 A8K379
LinkDB All DBs
Structure
PDB: 

Position
8q12.1
AA seq 512 aa AA seqDB search
MGCIKSKGKDSLSDDGVDLKTQPVRNTERTIYVRDPTSNKQQRPVPESQLLPGQRFQTKD
PEEQGDIVVALYPYDGIHPDDLSFKKGEKMKVLEEHGEWWKAKSLLTKKEGFIPSNYVAK
LNTLETEEWFFKDITRKDAERQLLAPGNSAGAFLIRESETLKGSFSLSVRDFDPVHGDVI
KHYKIRSLDNGGYYISPRITFPCISDMIKHYQKQADGLCRRLEKACISPKPQKPWDKDAW
EIPRESIKLVKRLGAGQFGEVWMGYYNNSTKVAVKTLKPGTMSVQAFLEEANLMKTLQHD
KLVRLYAVVTREEPIYIITEYMAKGSLLDFLKSDEGGKVLLPKLIDFSAQIAEGMAYIER
KNYIHRDLRAANVLVSESLMCKIADFGLARVIEDNEYTAREGAKFPIKWTAPEAINFGCF
TIKSDVWSFGILLYEIVTYGKIPYPGRTNADVMTALSQGYRMPRVENCPDELYDIMKMCW
KEKAEERPTFDYLQSVLDDFYTATEGQYQQQP
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgggatgtataaaatcaaaagggaaagacagcttgagtgacgatggagtagatttgaag
actcaaccagtacgtaatactgaaagaactatttatgtgagagatccaacgtccaataaa
cagcaaaggccagttccagaatctcagcttttacctggacagaggtttcaaactaaagat
ccagaggaacaaggagacattgtggtagccttgtacccctatgatggcatccacccggac
gacttgtctttcaagaaaggagagaagatgaaagtcctggaggagcatggagaatggtgg
aaagcaaagtcccttttaacaaaaaaagaaggcttcatccccagcaactatgtggccaaa
ctcaacaccttagaaacagaagagtggtttttcaaggatataaccaggaaggacgcagaa
aggcagcttttggcaccaggaaatagcgctggagctttccttattagagaaagtgaaaca
ttaaaaggaagcttctctctgtctgtcagagactttgaccctgtgcatggtgatgttatt
aagcactacaaaattagaagtctggataatgggggctattacatctctccacgaatcact
tttccctgtatcagcgacatgattaaacattaccaaaagcaggcagatggcttgtgcaga
agattggagaaggcttgtattagtcccaagccacagaagccatgggataaagatgcctgg
gagatcccccgggagtccatcaagttggtgaaaaggcttggcgctgggcagtttggggaa
gtctggatgggttactataacaacagtaccaaggtggctgtgaaaaccctgaagccagga
actatgtctgtgcaagccttcctggaagaagccaacctcatgaagaccctgcagcatgac
aagctcgtgaggctctacgctgtggtcaccagggaggagcccatttacatcatcaccgag
tacatggccaagggcagtttgctggatttcctgaagagcgatgaaggtggcaaagtgctg
cttccaaagctcattgacttttctgctcagattgcagagggaatggcatacatcgagcgg
aagaactacattcaccgggacctgcgagcagctaatgttctggtctccgagtcactcatg
tgcaaaattgcagattttggccttgctagagtaattgaagataatgagtacacagcaagg
gaaggtgctaagttccctattaagtggacggctccagaagcaatcaactttggatgtttc
actattaagtctgatgtgtggtcctttggaatcctcctatacgaaattgtcacctatggg
aaaattccctacccagggagaactaatgccgacgtgatgaccgccctgtcccagggctac
aggatgccccgtgtggagaactgcccagatgagctctatgacattatgaaaatgtgctgg
aaagaaaaggcagaagagagaccaacgtttgactacttacagagcgtcctggatgatttc
tacacagccacggaagggcaataccagcagcagccttag

KEGG   Homo sapiens (human): 6714Help
Entry
6714              CDS       T01001                                 

Gene name
SRC, ASV, SRC1, THC6, c-SRC, p60-Src
Definition
(RefSeq) SRC proto-oncogene, non-receptor tyrosine kinase
  KO
K05704  tyrosine-protein kinase Src [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa01522  Endocrine resistance
hsa04012  ErbB signaling pathway
hsa04015  Rap1 signaling pathway
hsa04062  Chemokine signaling pathway
hsa04137  Mitophagy - animal
hsa04144  Endocytosis
hsa04360  Axon guidance
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04530  Tight junction
hsa04540  Gap junction
hsa04611  Platelet activation
hsa04625  C-type lectin receptor signaling pathway
hsa04727  GABAergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04810  Regulation of actin cytoskeleton
hsa04912  GnRH signaling pathway
hsa04915  Estrogen signaling pathway
hsa04917  Prolactin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04921  Oxytocin signaling pathway
hsa04926  Relaxin signaling pathway
hsa05100  Bacterial invasion of epithelial cells
hsa05120  Epithelial cell signaling in Helicobacter pylori infection
hsa05131  Shigellosis
hsa05135  Yersinia infection
hsa05152  Tuberculosis
hsa05161  Hepatitis B
hsa05163  Human cytomegalovirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05168  Herpes simplex virus 1 infection
hsa05203  Viral carcinogenesis
hsa05205  Proteoglycans in cancer
hsa05219  Bladder cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (virus)
nt06135  Cytoskeletal regulation (virus)
nt06162  Hepatitis B virus (HBV)
nt06167  Human cytomegalovirus (HCMV)
  Element
N00393  ITGA/B-RhoA signaling pathway
N00394  HCMV gH to ITGA/B-RhoA signaling pathway
N00538  Ca2+-PYK2-RAS-ERK signaling pathway
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
N00540  HBV HBx to RAS-ERK signaling pathway
Disease
H00978  Thrombocytopenia (THC)
Drug target
Bosutinib (DG00718): D03252 D09728
Dasatinib (DG00714): D03658 D06414
Ilorasertib: D10423
Saracatinib (DG01418): D09664 D09665
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    6714 (SRC)
   04012 ErbB signaling pathway
    6714 (SRC)
   04370 VEGF signaling pathway
    6714 (SRC)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    6714 (SRC)
   04137 Mitophagy - animal
    6714 (SRC)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    6714 (SRC)
   04520 Adherens junction
    6714 (SRC)
   04530 Tight junction
    6714 (SRC)
   04540 Gap junction
    6714 (SRC)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    6714 (SRC)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    6714 (SRC)
   04625 C-type lectin receptor signaling pathway
    6714 (SRC)
   04062 Chemokine signaling pathway
    6714 (SRC)
  09152 Endocrine system
   04912 GnRH signaling pathway
    6714 (SRC)
   04915 Estrogen signaling pathway
    6714 (SRC)
   04917 Prolactin signaling pathway
    6714 (SRC)
   04921 Oxytocin signaling pathway
    6714 (SRC)
   04926 Relaxin signaling pathway
    6714 (SRC)
   04919 Thyroid hormone signaling pathway
    6714 (SRC)
  09156 Nervous system
   04727 GABAergic synapse
    6714 (SRC)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    6714 (SRC)
  09158 Development
   04360 Axon guidance
    6714 (SRC)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    6714 (SRC)
   05203 Viral carcinogenesis
    6714 (SRC)
  09162 Cancer: specific types
   05219 Bladder cancer
    6714 (SRC)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    6714 (SRC)
  09171 Infectious disease: bacterial
   05120 Epithelial cell signaling in Helicobacter pylori infection
    6714 (SRC)
   05131 Shigellosis
    6714 (SRC)
   05135 Yersinia infection
    6714 (SRC)
   05152 Tuberculosis
    6714 (SRC)
   05100 Bacterial invasion of epithelial cells
    6714 (SRC)
  09172 Infectious disease: viral
   05161 Hepatitis B
    6714 (SRC)
   05168 Herpes simplex virus 1 infection
    6714 (SRC)
   05163 Human cytomegalovirus infection
    6714 (SRC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    6714 (SRC)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    6714 (SRC)
   01522 Endocrine resistance
    6714 (SRC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    6714 (SRC)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    6714 (SRC)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     6714 (SRC)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   6714 (SRC)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    6714 (SRC)
 Endocytosis
  Clathrin-mediated endocytosis
   Kinases
    6714 (SRC)
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    6714 (SRC)
  Macropinocytosis
   Kinases
    6714 (SRC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 SH3_3 hSH3
Motif
Other DBs
NCBI-GeneID: 6714
NCBI-ProteinID: NP_005408
OMIM: 190090
HGNC: 11283
Ensembl: ENSG00000197122
Vega: OTTHUMG00000032417
Pharos: P12931(Tclin)
UniProt: P12931
LinkDB All DBs
Structure
PDB: 

Position
20q11.23
AA seq 536 aa AA seqDB search
MGSNKSKPKDASQRRRSLEPAENVHGAGGGAFPASQTPSKPASADGHRGPSAAFAPAAAE
PKLFGGFNSSDTVTSPQRAGPLAGGVTTFVALYDYESRTETDLSFKKGERLQIVNNTEGD
WWLAHSLSTGQTGYIPSNYVAPSDSIQAEEWYFGKITRRESERLLLNAENPRGTFLVRES
ETTKGAYCLSVSDFDNAKGLNVKHYKIRKLDSGGFYITSRTQFNSLQQLVAYYSKHADGL
CHRLTTVCPTSKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTL
KPGTMSPEAFLQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGSLLDFLKGETGKY
LRLPQLVDMAAQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYT
ARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVER
GYRMPCPPECPESLHDLMCQCWRKEPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atgggtagcaacaagagcaagcccaaggatgccagccagcggcgccgcagcctggagccc
gccgagaacgtgcacggcgctggcgggggcgctttccccgcctcgcagacccccagcaag
ccagcctcggccgacggccaccgcggccccagcgcggccttcgcccccgcggccgccgag
cccaagctgttcggaggcttcaactcctcggacaccgtcacctccccgcagagggcgggc
ccgctggccggtggagtgaccacctttgtggccctctatgactatgagtctaggacggag
acagacctgtccttcaagaaaggcgagcggctccagattgtcaacaacacagagggagac
tggtggctggcccactcgctcagcacaggacagacaggctacatccccagcaactacgtg
gcgccctccgactccatccaggctgaggagtggtattttggcaagatcaccagacgggag
tcagagcggttactgctcaatgcagagaacccgagagggaccttcctcgtgcgagaaagt
gagaccacgaaaggtgcctactgcctctcagtgtctgacttcgacaacgccaagggcctc
aacgtgaagcactacaagatccgcaagctggacagcggcggcttctacatcacctcccgc
acccagttcaacagcctgcagcagctggtggcctactactccaaacacgccgatggcctg
tgccaccgcctcaccaccgtgtgccccacgtccaagccgcagactcagggcctggccaag
gatgcctgggagatccctcgggagtcgctgcggctggaggtcaagctgggccagggctgc
tttggcgaggtgtggatggggacctggaacggtaccaccagggtggccatcaaaaccctg
aagcctggcacgatgtctccagaggccttcctgcaggaggcccaggtcatgaagaagctg
aggcatgagaagctggtgcagttgtatgctgtggtttcagaggagcccatttacatcgtc
acggagtacatgagcaaggggagtttgctggactttctcaagggggagacaggcaagtac
ctgcggctgcctcagctggtggacatggctgctcagatcgcctcaggcatggcgtacgtg
gagcggatgaactacgtccaccgggaccttcgtgcagccaacatcctggtgggagagaac
ctggtgtgcaaagtggccgactttgggctggctcggctcattgaagacaatgagtacacg
gcgcggcaaggtgccaaattccccatcaagtggacggctccagaagctgccctctatggc
cgcttcaccatcaagtcggacgtgtggtccttcgggatcctgctgactgagctcaccaca
aagggacgggtgccctaccctgggatggtgaaccgcgaggtgctggaccaggtggagcgg
ggctaccggatgccctgcccgccggagtgtcccgagtccctgcacgacctcatgtgccag
tgctggcggaaggagcctgaggagcggcccaccttcgagtacctgcaggccttcctggag
gactacttcacgtccaccgagccccagtaccagcccggggagaacctctag

DBGET integrated database retrieval system