KEGG   Homo sapiens (human): 2274Help
Entry
2274              CDS       T01001                                 

Gene name
FHL2, AAG11, DRAL, FHL-2, SLIM-3, SLIM3
Definition
(RefSeq) four and a half LIM domains 2
  KO
K14380  four and a half LIM domains protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development
   04380 Osteoclast differentiation
    2274 (FHL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LIM DUF1272 zf-ribbon_3 DUF2685
Motif
Other DBs
NCBI-GeneID: 2274
NCBI-ProteinID: NP_001034581
OMIM: 602633
HGNC: 3703
Ensembl: ENSG00000115641
Vega: OTTHUMG00000153120
Pharos: Q14192(Tbio)
UniProt: Q14192 Q6I9R8 Q2XQU9
LinkDB All DBs
Structure
PDB: 

Position
2q12.2
AA seq 279 aa AA seqDB search
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRH
WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS
SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQP
WHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgactgagcgctttgactgccaccattgcaacgaatctctctttggcaagaagtacatc
ctgcgggaggagagcccctactgcgtggtgtgctttgagaccctgttcgccaacacctgc
gaggagtgtgggaagcccatcggctgtgactgcaaggacttgtcttacaaggaccggcac
tggcatgaagcctgtttccactgctcgcagtgcagaaactcactggtggacaagcccttt
gctgccaaggaggaccagctgctctgtacagactgctattccaacgagtactcatccaag
tgccaggaatgcaagaagaccatcatgccaggtacccgcaagatggagtacaagggcagc
agctggcatgagacctgcttcatctgccaccgctgccagcagccaattggaaccaagagt
ttcatccccaaagacaatcagaatttctgtgtgccctgctatgagaaacaacatgccatg
cagtgcgttcagtgcaaaaagcccatcaccacgggaggggtcacttaccgggagcagccc
tggcacaaggagtgcttcgtgtgcaccgcctgcaggaagcagctgtctgggcagcgcttc
acagctcgcgatgactttgcctactgcctgaactgcttctgtgacttgtatgccaagaag
tgtgctgggtgcaccaaccccatcagcggacttggtggcacaaaatacatctcctttgag
gaacggcagtggcataacgactgctttaactgtaagaagtgctccctctcactggtgggg
cgtggcttcctcacagagagggacgacatcctgtgccccgactgtgggaaagacatctga

DBGET integrated database retrieval system