KEGG   Homo sapiens (human): 2274
Entry
2274              CDS       T01001                                 

Gene name
FHL2, AAG11, DRAL, FHL-2, SLIM-3, SLIM3
Definition
(RefSeq) four and a half LIM domains 2
  KO
K14380  four and a half LIM domains protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04380 Osteoclast differentiation
    2274 (FHL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    2274 (FHL2)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 LIM domain-containing proteins
  FHL family proteins
   2274 (FHL2)
SSDB
Motif
Pfam: LIM DUF1272 zf-ribbon_3 DUF2685
Other DBs
NCBI-GeneID: 2274
NCBI-ProteinID: NP_001034581
OMIM: 602633
HGNC: 3703
Ensembl: ENSG00000115641
Vega: OTTHUMG00000153120
Pharos: Q14192(Tbio)
UniProt: Q14192 Q6I9R8 Q2XQU9
LinkDB
Structure
PDB: 
2MIU 2D8Z 1X4K 1X4L

Position
2q12.2
AA seq 279 aa
MTERFDCHHCNESLFGKKYILREESPYCVVCFETLFANTCEECGKPIGCDCKDLSYKDRH
WHEACFHCSQCRNSLVDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS
SWHETCFICHRCQQPIGTKSFIPKDNQNFCVPCYEKQHAMQCVQCKKPITTGGVTYREQP
WHKECFVCTACRKQLSGQRFTARDDFAYCLNCFCDLYAKKCAGCTNPISGLGGTKYISFE
ERQWHNDCFNCKKCSLSLVGRGFLTERDDILCPDCGKDI
NT seq 840 nt   +upstreamnt  +downstreamnt
atgactgagcgctttgactgccaccattgcaacgaatctctctttggcaagaagtacatc
ctgcgggaggagagcccctactgcgtggtgtgctttgagaccctgttcgccaacacctgc
gaggagtgtgggaagcccatcggctgtgactgcaaggacttgtcttacaaggaccggcac
tggcatgaagcctgtttccactgctcgcagtgcagaaactcactggtggacaagcccttt
gctgccaaggaggaccagctgctctgtacagactgctattccaacgagtactcatccaag
tgccaggaatgcaagaagaccatcatgccaggtacccgcaagatggagtacaagggcagc
agctggcatgagacctgcttcatctgccaccgctgccagcagccaattggaaccaagagt
ttcatccccaaagacaatcagaatttctgtgtgccctgctatgagaaacaacatgccatg
cagtgcgttcagtgcaaaaagcccatcaccacgggaggggtcacttaccgggagcagccc
tggcacaaggagtgcttcgtgtgcaccgcctgcaggaagcagctgtctgggcagcgcttc
acagctcgcgatgactttgcctactgcctgaactgcttctgtgacttgtatgccaagaag
tgtgctgggtgcaccaaccccatcagcggacttggtggcacaaaatacatctcctttgag
gaacggcagtggcataacgactgctttaactgtaagaagtgctccctctcactggtgggg
cgtggcttcctcacagagagggacgacatcctgtgccccgactgtgggaaagacatctga

DBGET integrated database retrieval system