KEGG   Homo sapiens (human): 2277Help
Entry
2277              CDS       T01001                                 

Gene name
VEGFD, FIGF, VEGF-D
Definition
(RefSeq) vascular endothelial growth factor D
  KO
K05449  vascular endothelial growth factor C/D
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04668  TNF signaling pathway
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2277 (VEGFD)
   04015 Rap1 signaling pathway
    2277 (VEGFD)
   04010 MAPK signaling pathway
    2277 (VEGFD)
   04668 TNF signaling pathway
    2277 (VEGFD)
   04151 PI3K-Akt signaling pathway
    2277 (VEGFD)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2277 (VEGFD)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    2277 (VEGFD)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2277 (VEGFD)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    2277 (VEGFD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2277 (VEGFD)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2277 (VEGFD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDGF CXCXC
Motif
Other DBs
NCBI-GeneID: 2277
NCBI-ProteinID: NP_004460
OMIM: 300091
HGNC: 3708
Ensembl: ENSG00000165197
Vega: OTTHUMG00000021175
Pharos: O43915(Tbio)
UniProt: O43915
LinkDB All DBs
Structure
PDB: 

Position
Xp22.2
AA seq 354 aa AA seqDB search
MYREWVVVNVFMMLYVQLVQGSSNEHGPVKRSSQSTLERSEQQIRAASSLEELLRITHSE
DWKLWRCRLRLKSFTSMDSRSASHRSTRFAATFYDIETLKVIDEEWQRTQCSPRETCVEV
ASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVP
VKVANHTGCKCLPTAPRHPYSIIRRSIQIPEEDRCSHSKKLCPIDMLWDSNKCKCVLQEE
NPLAGTEDHSHLQEPALCGPHMMFDEDRCECVCKTPCPKDLIQHPKNCSCFECKESLETC
CQKHKLFHPDTCSCEDRCPFHTRPCASGKTACAKHCRFPKEKRAAQGPHSRKNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtacagagagtgggtagtggtgaatgttttcatgatgttgtacgtccagctggtgcag
ggctccagtaatgaacatggaccagtgaagcgatcatctcagtccacattggaacgatct
gaacagcagatcagggctgcttctagtttggaggaactacttcgaattactcactctgag
gactggaagctgtggagatgcaggctgaggctcaaaagttttaccagtatggactctcgc
tcagcatcccatcggtccactaggtttgcggcaactttctatgacattgaaacactaaaa
gttatagatgaagaatggcaaagaactcagtgcagccctagagaaacgtgcgtggaggtg
gccagtgagctggggaagagtaccaacacattcttcaagcccccttgtgtgaacgtgttc
cgatgtggtggctgttgcaatgaagagagccttatctgtatgaacaccagcacctcgtac
atttccaaacagctctttgagatatcagtgcctttgacatcagtacctgaattagtgcct
gttaaagttgccaatcatacaggttgtaagtgcttgccaacagccccccgccatccatac
tcaattatcagaagatccatccagatccctgaagaagatcgctgttcccattccaagaaa
ctctgtcctattgacatgctatgggatagcaacaaatgtaaatgtgttttgcaggaggaa
aatccacttgctggaacagaagaccactctcatctccaggaaccagctctctgtgggcca
cacatgatgtttgacgaagatcgttgcgagtgtgtctgtaaaacaccatgtcccaaagat
ctaatccagcaccccaaaaactgcagttgctttgagtgcaaagaaagtctggagacctgc
tgccagaagcacaagctatttcacccagacacctgcagctgtgaggacagatgccccttt
cataccagaccatgtgcaagtggcaaaacagcatgtgcaaagcattgccgctttccaaag
gagaaaagggctgcccaggggccccacagccgaaagaatccttga

DBGET integrated database retrieval system