KEGG   Homo sapiens (human): 229Help
Entry
229               CDS       T01001                                 

Gene name
ALDOB, ALDB, ALDO2
Definition
(RefSeq) aldolase, fructose-bisphosphate B
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00010  Glycolysis / Gluconeogenesis
hsa00030  Pentose phosphate pathway
hsa00051  Fructose and mannose metabolism
hsa01100  Metabolic pathways
hsa01200  Carbon metabolism
hsa01230  Biosynthesis of amino acids
hsa04066  HIF-1 signaling pathway
Module
hsa_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
hsa_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Network
nt06017  Glycogen metabolism
  Element
N00731  Glycolysis
N00733  LDHA deficiency in glycolysis
N00735  ENO3 deficiency in glycolysis
N00737  PGAM2 deficiency in glycolysis
Disease
H00071  Hereditary fructose intolerance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    229 (ALDOB)
   00030 Pentose phosphate pathway
    229 (ALDOB)
   00051 Fructose and mannose metabolism
    229 (ALDOB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    229 (ALDOB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    229 (ALDOB)
   03036 Chromosome and associated proteins [BR:hsa03036]
    229 (ALDOB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    229 (ALDOB)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     229 (ALDOB)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    229 (ALDOB)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    229 (ALDOB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   229 (ALDOB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycolytic
Motif
Other DBs
NCBI-GeneID: 229
NCBI-ProteinID: NP_000026
OMIM: 612724
HGNC: 417
Ensembl: ENSG00000136872
Vega: OTTHUMG00000020378
Pharos: P05062(Tbio)
UniProt: P05062 A0A024R145
LinkDB All DBs
Structure
PDB: 

Position
9q31.1
AA seq 364 aa AA seqDB search
MAHRFPALTQEQKKELSEIAQSIVANGKGILAADESVGTMGNRLQRIKVENTEENRRQFR
EILFSVDSSINQSIGGVILFHETLYQKDSQGKLFRNILKEKGIVVGIKLDQGGAPLAGTN
KETTIQGLDGLSERCAQYKKDGVDFGKWRAVLRIADQCPSSLAIQENANALARYASICQQ
NGLVPIVEPEVIPDGDHDLEHCQYVTEKVLAAVYKALNDHHVYLEGTLLKPNMVTAGHAC
TKKYTPEQVAMATVTALHRTVPAAVPGICFLSGGMSEEDATLNLNAINLCPLPKPWKLSF
SYGRALQASALAAWGGKAANKEATQEAFMKRAMANCQAAKGQYVHTGSSGAASTQSLFTA
CYTY
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggcccaccgatttccagccctcacccaggagcagaagaaggagctctcagaaattgcc
cagagcattgttgccaatggaaaggggatcctggctgcagatgaatctgtaggtaccatg
gggaaccgcctgcagaggatcaaggtggaaaacactgaagagaaccgccggcagttccga
gaaatcctcttctctgtggacagttccatcaaccagagcatcgggggtgtgatccttttc
cacgagaccctctaccagaaggacagccagggaaagctgttcagaaacatcctcaaggaa
aaggggatcgtggtgggaatcaagttagaccaaggaggtgctcctcttgcaggaacaaac
aaagaaaccaccattcaagggcttgatggcctctcagagcgctgtgctcagtacaagaaa
gatggtgttgactttgggaagtggcgtgctgtgctgaggattgccgaccagtgtccatcc
agcctcgctatccaggaaaacgccaacgccctggctcgctacgccagcatctgtcagcag
aatggactggtacctattgttgaaccagaggtaattcctgatggagaccatgacctggaa
cactgccagtatgttactgagaaggtcctggctgctgtctacaaggccctgaatgaccat
catgtttacctggagggcaccctgctaaagcccaacatggtgactgctggacatgcctgc
accaagaagtatactccagaacaagtagctatggccaccgtaacagctctccaccgtact
gttcctgcagctgttcctggcatctgctttttgtctggtggcatgagtgaagaggatgcc
actctcaacctcaatgctatcaacctttgccctctaccaaagccctggaaactaagtttc
tcttatggacgggccctgcaggccagtgcactggctgcctggggtggcaaggctgcaaac
aaggaggcaacccaggaggcttttatgaagcgggccatggctaactgccaggcggccaaa
ggacagtatgttcacacgggttcttctggggctgcttccacccagtcgctcttcacagcc
tgctatacctactag

DBGET integrated database retrieval system