KEGG   Homo sapiens (human): 22905Help
Entry
22905             CDS       T01001                                 

Gene name
EPN2, EHB21
Definition
(RefSeq) epsin 2
  KO
K12471  epsin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    22905 (EPN2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    22905 (EPN2)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    22905 (EPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH VHS
Motif
Other DBs
NCBI-GeneID: 22905
NCBI-ProteinID: NP_055779
OMIM: 607263
HGNC: 18639
Ensembl: ENSG00000072134
Vega: OTTHUMG00000187034
Pharos: O95208(Tdark)
UniProt: O95208
LinkDB All DBs
Position
17p11.2
AA seq 641 aa AA seqDB search
MTTSSIRRQMKNIVNNYSEAEIKVREATSNDPWGPSSSLMTEIADLTYNVVAFSEIMSMV
WKRLNDHGKNWRHVYKALTLLDYLIKTGSERVAQQCRENIFAIQTLKDFQYIDRDGKDQG
INVREKSKQLVALLKDEERLKAERAQALKTKERMAQVATGMGSNQITFGRGSSQPNLSTS
HSEQEYGKAGGSPASYHGSPEASLCPQHRTGAPLGQSEELQPLSQRHPFLPHLGLASRPN
GDWSQPCLTCDRAARATSPRVSSELEQARPQTSGEEELQLQLALAMSREVAEQEERLRRG
DDLRLQMALEESRRDTVKIPKKKEHGSLPQQTTLLDLMDALPSSGPAAQKAEPWGPSAST
NQTNPWGGPAAPASTSDPWPSFGTKPAASIDPWGVPTGATVQSVPKNSDPWAASQQPASS
AGKRASDAWGAVSTTKPVSVSGSFELFSNLNGTIKDDFSEFDNLRTSKKTAESVTSLPSQ
NNGTTSPDPFESQPLTVASSKPSSARKTPESFLGPNAALVNLDSLVTRPAPPAQSLNPFL
APGAPATSAPVNPFQVNQPQPLTLNQLRGSPVLGTSTSFGPGPGVESMAVASMTSAAPQP
ALGATGSSLTPLGPAMMNMVGSVGIPPSAAQATGTTNPFLL
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttcgtctatcagacggcagatgaaaaacatcgtgaacaattactcagaggca
gaaatcaaagtccgggaagccacctccaatgacccgtggggcccgtccagttctctgatg
accgagattgccgacctgacctacaacgtggtggccttctcggagatcatgagcatggtg
tggaagcggctgaatgaccatggcaagaactggcggcatgtgtacaaggcgctgaccctg
ctggactacctcatcaagacaggctccgaacgtgtggcccagcagtgccgggagaacatc
ttcgccatccagaccctgaaggacttccagtacattgaccgagatggcaaggaccagggc
atcaatgtgcgtgagaagtcaaagcaactggtggctctcctcaaggacgaggaacggttg
aaggctgagagggcccaggctctcaaaaccaaagagcgcatggcccaggttgccactggc
atgggcagcaaccagatcacctttgggcgaggctccagccagcccaacctctccaccagc
cactcggagcaggagtatggcaaggccgggggctccccggcctcctaccatggctcgcct
gaggcctcgctgtgcccccagcaccgcacaggggccccgctgggtcagagtgaggagctg
cagccactgagccagcgccaccccttcctgccgcacctggggctggcctcccgcccaaat
ggcgactggtcccagccctgcctcacttgtgaccgcgcagcccgagccacctccccgcga
gtgtcctccgagctggagcaagcccggccccagactagtggagaagaggagcttcagctg
cagctggcacttgccatgagcagagaagtggctgagcaggaagaacgcctcaggcggggt
gatgacctcagattacagatggccctggaagaaagccgaagggacacagttaaaattcca
aaaaagaaagagcatggctctctcccacagcagactacgctgttggatttaatggatgct
ctccccagctcgggccccgcggcccagaaagcagagccctggggcccgtcagcctccact
aaccagaccaacccctggggcgggccagcggctcctgcgagtacttcagacccctggcca
tcgtttggtaccaagccagctgcctccattgacccatggggggtgcccactggagccacc
gtacaatctgtccccaagaactcggacccctgggcagcttcacagcagcctgcctccagt
gctgggaaaagagcttctgacgcgtggggcgcagtctccaccaccaagcccgtgtctgtc
tctgggtcctttgagctcttcagtaatctgaatggtacaattaaagatgacttttctgaa
tttgacaaccttcggacttcaaaaaaaacagccgaatctgtgacctctctgccatcccaa
aacaatggaactaccagccctgacccctttgagtctcaacccctgactgtcgcctcaagc
aagcccagcagtgcccggaaaacacctgagtccttcctgggccccaacgcggccctggtg
aacctggactcactggtgaccaggcctgccccaccagcccagtccctcaaccctttcctg
gcaccaggtgctcccgccacctcggcccctgttaaccctttccaggtgaaccagccccag
ccgctgacactgaaccagcttcgggggagcccagtcctggggaccagcacatcctttggg
cctggcccaggagtggagtccatggctgtggcctcgatgacctccgcggccccacagcca
gctctgggggccactggttcctctctgacaccactgggccctgcaatgatgaacatggtg
ggcagtgtgggtatacccccatcagcagcccaggccactggcacaaccaaccctttcctt
ctctag

KEGG   Homo sapiens (human): 29924Help
Entry
29924             CDS       T01001                                 

Gene name
EPN1
Definition
(RefSeq) epsin 1
  KO
K12471  epsin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    29924 (EPN1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    29924 (EPN1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    29924 (EPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH ANTH UIM VHS
Motif
Other DBs
NCBI-GeneID: 29924
NCBI-ProteinID: NP_001123544
OMIM: 607262
HGNC: 21604
Ensembl: ENSG00000063245
Vega: OTTHUMG00000180911
Pharos: Q9Y6I3(Tbio)
UniProt: Q9Y6I3 A0A024R4S1
LinkDB All DBs
Structure
PDB: 

Position
19q13.42
AA seq 576 aa AA seqDB search
MSTSSLRRQMKNIVHNYSEAEIKVREATSNDPWGPSSSLMSEIADLTYNVVAFSEIMSMI
WKRLNDHGKNWRHVYKAMTLMEYLIKTGSERVSQQCKENMYAVQTLKDFQYVDRDGKDQG
VNVREKAKQLVALLRDEDRLREERAHALKTKEKLAQTATASSAAVGSGPPPEAEQAWPQS
SGEEELQLQLALAMSKEEADQPPSCGPEDDAQLQLALSLSREEHDKEERIRRGDDLRLQM
AIEESKRETGGKEESSLMDLADVFTAPAPAPTTDPWGGPAPMAAAVPTAAPTSDPWGGPP
VPPAADPWGGPAPTPASGDPWRPAAPAGPSVDPWGGTPAPAAGEGPTPDPWGSSDGGVPV
SGPSASDPWTPAPAFSDPWGGSPAKPSTNGTTAAGGFDTEPDEFSDFDRLRTALPTSGSS
AGELELLAGEVPARSPGAFDMSGVRGSLAEAVGSPPPAATPTPTPPTRKTPESFLGPNAA
LVDLDSLVSRPGPTPPGAKASNPFLPGGGPATGPSVTNPFQPAPPATLTLNQLRLSPVPP
VPGAPPTYISPLGGGPGLPPMMPPGPPAPNTNPFLL
NT seq 1731 nt NT seq  +upstreamnt  +downstreamnt
atgtcgacctcgtccttgaggcgccagatgaagaacatcgtccacaactactcagaggcg
gagatcaaggttcgagaggccacgagcaatgacccctggggcccatccagctccctcatg
tcagagattgccgacctcacctacaacgttgtcgccttctcggagatcatgagcatgatc
tggaagcggctcaatgaccatggcaagaactggcgtcacgtttacaaggccatgacgctg
atggagtacctcatcaagaccggctcggagcgcgtgtcgcagcagtgcaaggagaacatg
tacgccgtgcagacgctgaaggacttccagtacgtggaccgcgacggcaaggaccagggc
gtgaacgtgcgtgagaaagctaagcagctggtggccctgctgcgcgacgaggaccggctg
cgggaagagcgggcgcacgcgctcaagaccaaggaaaagctggcacagaccgccacggcc
tcatcagcagctgtgggctcaggcccccctcccgaggcggagcaggcgtggccgcagagc
agcggggaggaggagctgcagctccagctggccctggccatgagcaaggaggaggccgac
cagcccccgtcctgcggccccgaggacgacgcccagctccagctggcccttagtttgagc
cgagaagagcatgataaggaggagcggatccgtcgcggggatgacctgcggctgcagatg
gcaatcgaggagagcaagagggagactgggggcaaggaggagtcgtccctcatggacctt
gctgacgtcttcacggccccagctcctgccccgaccacagacccctgggggggcccagca
cccatggctgctgccgtccccacggctgcccccacctcggacccctggggcggcccccct
gtccctccagctgctgatccctggggaggtccagcccccacgccggcctctggggacccc
tggaggcctgctgcccctgcaggaccctcagttgacccttggggtgggaccccagcccct
gcagctggggaggggcccacgcctgatccatggggaagttccgatggtggggtcccggtc
agtgggccctcagcctccgatccctggacaccggccccggccttctcagatccctgggga
gggtcacctgccaagcccagcaccaatggcacaacagcagccgggggattcgacacggag
cccgacgagttctctgactttgaccgactccgcacggcactgccgacctccgggagcagc
gcaggagagctggagctgctggcaggagaggtgccggcccgaagccctggggcgtttgac
atgagtggggtcaggggatctctggctgaggctgtgggcagccccccacctgcagccaca
ccaactcccacgccccccacccggaagacgccggagtcattcctggggcccaatgcagcc
ctcgtcgacctggactcgctggtgagccggccgggccccacgccgcctggagccaaggcc
tccaaccccttcctgccaggcggaggcccagccactggcccttccgtcaccaaccccttc
cagcccgcgcctcccgcgacgctcaccctgaaccagctccgtctcagtcctgtgcctccc
gtccctggagcgccacccacgtacatctctccccttggcgggggccctggcctgcccccc
atgatgcccccgggccccccggcccccaacactaatcccttcctcctataa

KEGG   Homo sapiens (human): 55040Help
Entry
55040             CDS       T01001                                 

Gene name
EPN3
Definition
(RefSeq) epsin 3
  KO
K12471  epsin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    55040 (EPN3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    55040 (EPN3)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    55040 (EPN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ENTH UIM ANTH VHS
Motif
Other DBs
NCBI-GeneID: 55040
NCBI-ProteinID: NP_060427
OMIM: 607264
HGNC: 18235
Ensembl: ENSG00000049283
Vega: OTTHUMG00000162155
Pharos: Q9H201(Tbio)
UniProt: Q9H201
LinkDB All DBs
Position
17q21.33
AA seq 632 aa AA seqDB search
MTTSALRRQVKNIVHNYSEAEIKVREATSNDPWGPPSSLMSEIADLTFNTVAFTEVMGML
WRRLNDSGKNWRHVYKALTLLDYLLKTGSERVAHQCRENLYTIQTLKDFQYIDRDGKDQG
VNVREKVKQVMALLKDEERLRQERTHALKTKERMALEGIGIGSGQLGFSRRYGEDYSRSR
GSPSSYNSSSSSPRYTSDLEQARPQTSGEEELQLQLALAMSREEAEKPVPPASHRDEDLQ
LQLALRLSRQEHEKEVRSWQGDGSPMANGAGAVVHHQRDREPEREERKEEEKLKTSQSSI
LDLADIFVPALAPPSTHCSADPWDIPGFRPNTEASGSSWGPSADPWSPIPSGTVLSRSQP
WDLTPMLSSSEPWGRTPVLPAGPPTTDPWALNSPHHKLPSTGADPWGASLETSDTPGGAS
TFDPFAKPPESTETKEGLEQALPSGKPSSPVELDLFGDPSPSSKQNGTKEPDALDLGILG
EALTQPSKEARACRTPESFLGPSASSLVNLDSLVKAPQVAKTRNPFLTGLSAPSPTNPFG
AGEPGRPTLNQMRTGSPALGLAGGPVGAPLGSMTYSASLPLPLSSVPAGLTLPASVSVFP
QAGAFAPQPLLPTPSSAGPRPPPPQTGTNPFL
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctccgcactccggcgccaggtgaagaacatcgtgcacaactactccgaggca
gaaatcaaggtgcgcgaggccaccagcaatgacccctggggcccccctagttcgctcatg
tccgagatcgctgacctgaccttcaacacagtggccttcaccgaagtcatgggcatgctg
tggcggcggctcaatgacagcggcaagaactggcggcacgtgtacaaggctctaacattg
ctggactacctgctcaagacgggctccgagcgggtggcccaccagtgccgcgagaacctc
tacaccatccagacactcaaggacttccagtacatcgaccgcgacggcaaggaccagggc
gtcaacgtgcgcgagaaggtcaagcaggtgatggccctgctcaaggatgaggagcggctg
cggcaggagcgaacccacgccctcaagaccaaggagcgcatggcactggagggcatcggc
attggcagtgggcagctgggcttcagccgccgctacggcgaggactacagccgctcccgg
ggctccccgtcctcctacaactcctcctcttcgtcaccccgctatacctccgacctggag
caggcccggcctcagacgtcaggggaagaggaactgcagctgcagctggccctcgccatg
agccgtgaggaggcagagaagcctgtccccccagcctcccacagggacgaggacctgcag
ctgcagctggctctgcgcctgagccggcaggagcacgagaaggaggtgaggtcctggcag
ggtgatggctcccccatggccaatggtgcaggggccgtggtccaccatcagcgggacaga
gagcctgagagagaagagagaaaggaggaggagaagctaaaaaccagccagtcctccatc
ctggacttggctgacatcttcgtacctgccctggccccgccctccacacactgctctgct
gacccatgggacatcccaggttttaggccgaacacagaggccagtggatcctcctggggg
ccttctgcagacccctggtctccgatcccctcaggaaccgtcctgtcccgaagccagccc
tgggatctgactcccatgctctcctcctctgagccctggggcaggaccccagtgctgcct
gctgggccccccaccacagacccctgggccctgaactctccccaccacaaactccccagc
actggggctgacccttggggagcctccctggagacctccgacacacctggtggtgcctcg
acctttgacccatttgccaaacctccagaatccacagagaccaaggaggggctggagcag
gccctgccctctgggaagcccagcagccctgtggagctggacctgtttggagaccccagc
cccagttccaagcaaaatggcacgaaggagccagatgccctggacctgggcatactaggg
gaagcactaacccagccaagcaaagaggcccgagcttgccggactcccgagtccttcctg
ggtccctcagcttcctccttggtcaaccttgactcgttggtcaaggcaccccaggttgca
aagacccggaaccccttcctgacaggtctcagcgctccgtcccccaccaacccgttcggc
gcgggcgagccgggcaggccgacgctaaaccagatgcgcaccggctcgccggcgctgggc
ctggcaggcgggcctgtgggggcgcccctgggctccatgacctacagcgcctctctgccc
ctcccgctcagcagcgtgccagctggcttgaccctccccgcctcggttagcgtcttcccg
caggccggagccttcgcaccgcagccgctgctgcccacgccgagctcagccgggccgcgg
cccccgcccccgcagaccggcaccaaccccttcctctga

DBGET integrated database retrieval system