KEGG   Homo sapiens (human): 22938Help
Entry
22938             CDS       T01001                                 

Gene name
SNW1, Bx42, FUN20, NCOA-62, PRPF45, Prp45, SKIIP, SKIP, SKIP1
Definition
(RefSeq) SNW domain containing 1
  KO
K06063  SNW domain-containing protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03040  Spliceosome
hsa04330  Notch signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
nt06165  Epstein-Barr virus (EBV)
  Element
N00224  EBV EBNALP RBP-Jk-mediated transcription
N00225  EBV EBNA2 to RBP-Jk-mediated transcription
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    22938 (SNW1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    22938 (SNW1)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    22938 (SNW1)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    22938 (SNW1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    22938 (SNW1)
Spliceosome [BR:hsa03041]
 Complex B
  Other components
   Prp19-related factors
    22938 (SNW1)
 Complex C
    22938 (SNW1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SKIP_SNW
Motif
Other DBs
NCBI-GeneID: 22938
NCBI-ProteinID: NP_036377
OMIM: 603055
HGNC: 16696
Ensembl: ENSG00000100603
Vega: OTTHUMG00000171527
Pharos: Q13573(Tbio)
UniProt: Q13573
LinkDB All DBs
Structure
PDB: 

Position
14q24.3
AA seq 536 aa AA seqDB search
MALTSFLPAPTQLSQDQLEAEEKARSQRSRQTSLVSSRREPPPYGYRKGWIPRLLEDFGD
GGAFPEIHVAQYPLDMGRKKKMSNALAIQVDSEGKIKYDAIARQGQSKDKVIYSKYTDLV
PKEVMNADDPDLQRPDEEAIKEITEKTRVALEKSVSQKVAAAMPVRAADKLAPAQYIRYT
PSQQGVAFNSGAKQRVIRMVEMQKDPMEPPRFKINKKIPRGPPSPPAPVMHSPSRKMTVK
EQQEWKIPPCISNWKNAKGYTIPLDKRLAADGRGLQTVHINENFAKLAEALYIADRKARE
AVEMRAQVERKMAQKEKEKHEEKLREMAQKARERRAGIKTHVEKEDGEARERDEIRHDRR
KERQHDRNLSRAAPDKRSKLQRNENRDISEVIALGVPNPRTSNEVQYDQRLFNQSKGMDS
GFAGGEDEIYNVYDQAWRGGKDMAQSIYRPSKNLDKDMYGDDLEARIKTNRFVPDKEFSG
SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEGKKRRKE
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgctcaccagctttttacctgcacctactcagctatctcaggaccagcttgaggct
gaagaaaaggcaagatcccagagatcacggcagacctcactggtctcctcccgaagagaa
cctcccccgtacggataccggaaaggctggatacctcggttattagaggattttggagat
ggaggtgcttttccagagatccatgtggcccagtatccactggatatgggacgaaagaaa
aaaatgtcgaatgcgctggccattcaggtggattctgaaggaaaaattaaatatgatgca
attgctcgacaaggacagtcaaaagacaaggtcatttatagcaaatacactgacctggtt
ccaaaggaggttatgaatgcagatgatccagacctgcaaaggcccgatgaagaagctatt
aaagagataacagaaaagacaagagtagccttagaaaaatctgtatcacagaaggtcgcc
gcagccatgccagttcgagcagctgacaaattggctcctgctcagtatatccgatacaca
ccatctcagcaaggagtggcattcaactctggagctaaacagagggttattcggatggta
gaaatgcagaaagatccaatggagcctccaaggttcaagattaataagaaaattccccgg
ggaccaccttctcctcctgcgcctgtcatgcattctcctagccgaaagatgactgtaaag
gaacaacaagagtggaagattcctccttgtatttctaactggaaaaatgcaaagggttat
acaattccattagacaaacgtctggctgctgatggaagaggactacagacagtacacata
aatgaaaatttcgccaaattggcagaagccctctacattgctgatcggaaggctcgtgaa
gctgtggaaatgcgtgcccaagtagagagaaaaatggctcagaaagaaaaggaaaaacat
gaagagaaacttagagaaatggcccagaaagccagggagagaagagctgggatcaaaact
catgtggaaaaagaggatggggaggcacgtgagagggatgaaatccggcatgacaggcga
aaagagagacagcatgaccggaatctttccagggcagctcctgataagaggtcgaaactt
cagagaaatgaaaatcgggatatcagtgaagttattgctctcggtgttcctaatcctcgg
acttccaatgaagttcagtatgaccaaaggctcttcaaccaatccaagggtatggacagt
ggatttgcaggtggagaagatgaaatttataatgtttatgatcaagcctggagaggtggt
aaagatatggcccagagtatttataggcccagtaaaaatctggacaaggacatgtatggt
gatgacctagaagccagaataaagaccaacagatttgttcccgacaaggagttttctggt
tcagaccgtagacagagaggccgagaaggaccagtgcagtttgaggaagatccttttggt
ttggacaagtttttggaagaagccaaacagcatggtggctctaaaagaccctcagatagc
agccgccccaaggaacacgagcatgaaggcaagaagaggaggaaggaatag

DBGET integrated database retrieval system