KEGG   Homo sapiens (human): 22953
Entry
22953             CDS       T01001                                 

Gene name
P2RX2, DFNA41, P2X2
Definition
(RefSeq) purinergic receptor P2X 2
  KO
K05216  P2X purinoceptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04742  Taste transduction
Disease
H00604  Deafness, autosomal dominant
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    22953 (P2RX2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    22953 (P2RX2)
 09150 Organismal Systems
  09157 Sensory system
   04742 Taste transduction
    22953 (P2RX2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    22953 (P2RX2)
Ion channels [BR:hsa04040]
 Ligand-gated channels
  ATP-gated cation channel (P2X)
   22953 (P2RX2)
SSDB
Motif
Pfam: P2X_receptor WAP
Other DBs
NCBI-GeneID: 22953
NCBI-ProteinID: NP_733782
OMIM: 600844
HGNC: 15459
Ensembl: ENSG00000187848
Vega: OTTHUMG00000168018
Pharos: Q9UBL9(Tbio)
UniProt: Q9UBL9 Q32MC3
LinkDB
Position
12q24.33
AA seq 471 aa
MAAAQPKYPAGATARRLARGCWSALWDYETPKVIVVRNRRLGVLYRAVQLLILLYFVWYV
FIVQKSYQESETGPESSIITKVKGITTSEHKVWDVEEYVKPPEGGSVFSIITRVEATHSQ
TQGTCPESIRVHNATCLSDADCVAGELDMLGNGLRTGRCVPYYQGPSKTCEVFGWCPVED
GASVSQFLGTMAPNFTILIKNSIHYPKFHFSKGNIADRTDGYLKRCTFHEASDLYCPIFK
LGFIVEKAGESFTELAHKGGVIGVIINWDCDLDLPASECNPKYSFRRLDPKHVPASSGYN
FRFAKYYKINGTTTRTLIKAYGIRIDVIVHGQAGKFSLIPTIINLATALTSVGVGSFLCD
WILLTFMNKNKVYSHKKFDKVCTPSHPSGSWPVTLARVLGQAPPEPGHRSEDQHPSPPSG
QEGQQGAECGPAFPPLRPCPISAPSEQMVDTPASEPAQASTPTDPKGLAQL
NT seq 1416 nt   +upstreamnt  +downstreamnt
atggccgccgcccagcccaagtaccccgccggggcgaccgcccggcgcctggcccggggc
tgctggtccgccctctgggactacgagacgcccaaggtgatcgtggtgaggaaccggcgc
ctgggggtcctgtaccgcgccgtgcagctgctcatcctgctctacttcgtgtggtacgta
ttcatcgtgcagaaaagctaccaggagagcgagacgggccccgagagctccatcatcacc
aaggtcaaggggatcaccacgtccgagcacaaagtgtgggacgtggaggagtacgtgaag
ccccccgaggggggcagcgtgttcagcatcatcaccagggtcgaggccacccactcccag
acccagggaacctgccccgagagcataagggtccacaacgccacctgcctctccgacgcc
gactgcgtggctggggagctggacatgctgggaaacggcctgaggactgggcgctgtgtg
ccctattaccaggggccctccaagacctgcgaggtgttcggctggtgcccggtggaagat
ggggcctctgtcagccaatttctgggtacgatggccccaaatttcaccatcctcatcaag
aacagcatccactaccccaaattccacttctccaagggcaacatcgccgaccgcacagac
gggtacctgaagcgctgcacgttccacgaggcctccgacctctactgccccatcttcaag
ctgggctttatcgtggagaaggctggggagagcttcacagagctcgcacacaagggtggt
gtcatcggggtcattatcaactgggactgtgacctggacctgcctgcatcggagtgcaac
cccaagtactccttccggaggcttgaccccaagcacgtgcctgcctcgtcaggctacaac
ttcaggtttgccaaatactacaagatcaatggcaccaccacccgcacgctcatcaaggcc
tacgggatccgcattgacgtcattgtgcatggacaggccgggaagttcagcctgattccc
accattattaatctggccacagctctgacttccgtcggggtgggctccttcctgtgcgac
tggatcttgctaacattcatgaacaaaaacaaggtctacagccataagaaatttgacaag
gtgtgtacgccgagccacccctcaggtagctggcctgtgacccttgcccgtgtattgggc
caggcccctcccgaacccggccaccgctccgaggaccagcaccccagccctccatcaggc
caggagggccaacaaggggcagagtgtggcccagccttcccgcccctgcggccttgcccc
atctctgccccttctgagcagatggtggacactcctgcctccgagcctgcccaagcctcc
acacccacagaccccaaaggtttggctcaactctga

DBGET integrated database retrieval system