KEGG   Homo sapiens (human): 2299
Entry
2299              CDS       T01001                                 

Gene name
FOXI1, FKH10, FKHL10, FREAC-6, FREAC6, HFH-3, HFH3
Definition
(RefSeq) forkhead box I1
  KO
K09401  forkhead box protein I
Organism
hsa  Homo sapiens (human)
Disease
H00251  Thyroid dyshormonogenesis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2299 (FOXI1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2299 (FOXI1)
SSDB
Motif
Pfam: Forkhead
Other DBs
NCBI-GeneID: 2299
NCBI-ProteinID: NP_036320
OMIM: 601093
HGNC: 3815
Ensembl: ENSG00000168269
Vega: OTTHUMG00000130436
Pharos: Q12951(Tbio)
UniProt: Q12951 E0XEN6
LinkDB
Position
5q35.1
AA seq 378 aa
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPN
PYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGGSDLGWLPIPSQEELMK
LVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDC
FKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTASLALEKTESSLPV
DSPKTTEPQDILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSPTSHPLV
TPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGGSVLSQFSPHF
YNSVNTSGVLYPREGTEV
NT seq 1137 nt   +upstreamnt  +downstreamnt
atgagctccttcgacctgccggcgccctccccacctcgctgcagcccccagttccccagc
atcggccaggagccccccgagatgaacctctactatgagaacttcttccacccacagggc
gtgcccagccctcagcggccctccttcgaggggggcggcgagtatggggccacccccaac
ccctacctctggttcaacgggcccaccatgaccccgccaccctacctgcccggccccaac
gccagccccttcctgccccaggcctatggagtgcagaggccgctgctgcccagcgtgtcg
gggcttggggggagcgacctgggctggctgcccatcccctcgcaggaggagctgatgaag
ctggtgcggccaccctattcctactcggctctcatcgccatggccatccacggggcaccc
gacaagcgcctcactctcagccagatctaccagtacgtggccgacaacttccccttctac
aacaagagcaaggccggctggcagaactccatccgccacaacctgtcgctcaacgactgc
ttcaagaaggtgccccgcgacgaggacgacccgggcaaagggaattactggaccctggac
cccaactgtgagaaaatgttcgacaatggaaatttccgcaggaaaaggaagagaaaatca
gatgtttcctctagcacagcctccttggccttagagaagacagagagcagtctcccggtg
gacagccccaagaccacggagcctcaggacatcttggatggagcctcaccagggggcacc
accagctccccagagaagcggccctcccctcccccatcaggcgccccttgccttaacagc
ttcctttcctctatgacagcctatgtgagcggggggagccccacgagccaccccttggtc
acaccaggactgagccctgagcccagtgacaagacggggcagaactcactgaccttcaac
tccttctccccgctcaccaacctcagcaaccacagcggtgggggtgactgggcgaacccc
atgcccaccaacatgctcagctatggaggatctgtgctcagccaattcagccctcacttc
tacaacagtgtcaacaccagtggtgtcctctaccccagggagggcaccgaggtctag

DBGET integrated database retrieval system