KEGG   Homo sapiens (human): 23035
Entry
23035             CDS       T01001                                 

Gene name
PHLPP2, PHLPPL, PPM3B
Definition
(RefSeq) PH domain and leucine rich repeat protein phosphatase 2
  KO
K16340  PH domain and leucine-rich repeat-containing protein phosphatase [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    23035 (PHLPP2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23035 (PHLPP2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     23035 (PHLPP2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    23035 (PHLPP2)
SSDB
Motif
Pfam: LRR_8 LRR_4 PP2C LRR_6 PH
Other DBs
NCBI-GeneID: 23035
NCBI-ProteinID: NP_055835
OMIM: 611066
HGNC: 29149
Ensembl: ENSG00000040199
Vega: OTTHUMG00000176867
Pharos: Q6ZVD8(Tbio)
UniProt: Q6ZVD8
LinkDB
Position
16q22.2
AA seq 1323 aa
MKRNGSRNCLNRRSRFGSRERDWLREDVKRGCVYLYGADTTTATTTTTTSSSSSSSSSSS
DLHLVLCTVETPASEICAGEGRESLYLQLHGDLVRRLEPTERPLQIVYDYLSRLGFDDPV
RIQEEATNPDLGCMIRFYGEKPCHMDRLDRILLSGIYNVRKGKTQLHKWAERLVVLCGTC
LIVSSVKDCQTGKMHILPLVGGKIEEVKRRQYSLAFSSAGAQAQTYHVSFETLAEYQRWQ
RQASKVVSQRISTVDLSCYSLEEVPEHLFYSQDITYLNLRHNFMQLERPGGLDTLYKFSQ
LKGLNLSHNKLGLFPILLCEISTLTELNLSCNGFHDLPSQIGNLLNLQTLCLDGNFLTTL
PEELGNLQQLSSLGISFNNFSQIPEVYEKLTMLDRVVMAGNCLEVLNLGVLNRMNHIKHV
DLRMNHLKTMVIENLEGNKHITHVDLRDNRLTDLDLSSLCSLEQLHCGRNQLRELTLSGF
SLRTLYASSNRLTAVNVYPVPSLLTFLDLSRNLLECVPDWACEAKKIEVLDVSYNLLTEV
PVRILSSLSLRKLMLGHNHVQNLPTLVEHIPLEVLDLQHNALTRLPDTLFSKALNLRYLN
ASANSLESLPSACTGEESLSMLQLLYLTNNLLTDQCIPVLVGHLHLRILHLANNQLQTFP
ASKLNKLEQLEELNLSGNKLKTIPTTIANCKRLHTLVAHSNNISIFPEILQLPQIQFVDL
SCNDLTEILIPEALPATLQDLDLTGNTNLVLEHKTLDIFSHITTLKIDQKPLPTTDSTVT
STFWSHGLAEMAGQRNKLCVSALAMDSFAEGVGAVYGMFDGDRNEELPRLLQCTMADVLL
EEVQQSTNDTVFMANTFLVSHRKLGMAGQKLGSSALLCYIRPDTADPASSFSLTVANVGT
CQAVLCRGGKPVPLSKVFSLEQDPEEAQRVKDQKAIITEDNKVNGVTCCTRMLGCTYLYP
WILPKPHISSTPLTIQDELLILGNKALWEHLSYTEAVNAVRHVQDPLAAAKKLCTLAQSY
GCQDNVGAMVVYLNIGEEGCTCEMNGLTLPGPVGFASTTTIKDAPKPATPSSSSGIASEF
SSEMSTSEVSSEVGSTASDEHNAGGLDTALLPRPERRCSLHPTPTSGLFQRQPSSATFSS
NQSDNGLDSDDDQPVEGVITNGSKVEVEVDIHCCRGRDLENSPPLIESSPTLCSEEHARG
SCFGIRRQNSVNSGMLLPMSKDRMELQKSPSTSCLYGKKLSNGSIVPLEDSLNLIEVATE
VPKRKTGYFAAPTQMEPEDQFVVPHDLEEEVKEQMKQHQDSRLEPEPHEEDRTEPPEEFD
TAL
NT seq 3972 nt   +upstreamnt  +downstreamnt
atgaaacgcaatgggagcagaaattgtttgaataggagaagtaggtttggttctcgagaa
agagactggctaagagaagatgtaaagagaggctgtgtttacctttatggagcagacact
accactgccactacaaccaccaccacctcctcttcctcttcctcctcctcctcttcctct
gacttacatctcgtcctttgcactgtagagacaccagcatcagaaatatgtgctggagag
ggaagagaaagtctttatttacagcttcatggagacctggtcaggagactggaacctact
gaacgacctcttcagatcgtttatgattacttatccaggctgggatttgatgatcctgtg
cgcatacaggaggaggctacaaatcctgacctcggctgtatgattcgattttatggtgaa
aaaccatgccacatggatcgtttggatcgaatcctattgtctggcatctataatgtacgc
aagggaaagacccagctgcataagtgggctgagcgcctagttgtcctctgtggtacctgc
cttatcgtttcctcagtgaaggattgtcaaactggaaagatgcacattttgcctctggtt
ggtggaaagatagaagaagtgaagcgacggcaatactcccttgctttcagctcagcagga
gcccaagctcagacctatcatgtcagcttcgagactttggccgagtaccagcgatggcaa
cggcaagcatccaaggtggtgtcccagcgaatcagtaccgtggatctctcgtgttacagc
ctcgaggaggttcctgagcatctcttctatagtcaagatattacctacctcaacttgcga
cacaacttcatgcagttagaaagacccggaggcctcgatacactctacaaattttctcaa
ctgaagggcctgaacttgtcccataataaacttgggttgtttcctatattgttatgcgag
atctctaccctgactgagctcaacctttcctgtaatggatttcatgacctaccaagtcaa
attggcaatctgctaaatcttcaaaccctctgtcttgatggcaactttctgactacttta
cctgaagaattgggaaatctacaacagctttcctccttgggaatttccttcaacaacttt
agtcaaattcctgaggtttatgagaaactcactatgttagatagagtggttatggcagga
aattgcctggaagtcctgaacttaggggtgctgaataggatgaaccatatcaagcatgtg
gatttaaggatgaaccatttgaaaaccatggttattgaaaatctggagggaaataaacac
atcacccacgtggatctgcgggacaaccgactgactgacttggatcttagctccttatgc
agcttggaacagctgcactgtgggcggaatcagctgagggagctaacactcagtggcttt
tcccttcggaccctctatgccagttccaacaggctgacagcagtgaacgtctatccagta
cccagcctgctcactttcttggatctctcccgaaacctgctagagtgtgtccctgactgg
gcctgtgaagcaaagaagatagaagtattagatgtgagctataatcttctcacagaggtt
cccgtgagaattctgagtagcttgagtcttagaaaactgatgctgggacacaatcatgtg
caaaaccttccaacactggtagagcacatccccctcgaggtgctggatcttcagcataat
gcactcacgaggctgccagacaccctcttctccaaggccttaaatctcagatacttgaat
gcatctgcaaatagtctggagtctttaccatccgcctgcactggagaggagagtttgagt
atgctgcagctgctttatctgaccaacaatctcctgacggatcagtgcatacctgtcctg
gtagggcacctgcacctgcgaatcttgcaccttgcaaacaatcagttacagacctttcct
gcaagcaaactaaataaattggagcaattggaggaactgaacctaagtggcaacaagctt
aaaaccattcccacaaccatagcaaactgtaaaaggctgcacacccttgttgcacactcc
aacaacatcagcattttcccagaaatactgcagttgcctcagatccagtttgtagaccta
agttgcaacgacttgacagaaatcctgattccagaggctttgcctgctacattacaagac
cttgacctgactggaaatacaaatctggttctggaacacaagacactggacatatttagc
catatcacaaccctgaaaattgatcagaaacctttgccaaccacagattctacagttacg
tcaaccttctggagccatggactggctgagatggcagggcagagaaataagctgtgtgtc
tcagcacttgctatggatagctttgcagagggggtgggagctgtgtatggcatgtttgat
ggagaccgaaatgaggagctcccgcgcctgctgcagtgtacgatggcagatgtgctttta
gaagaggtacagcagtcaactaatgacacagttttcatggctaacaccttcttggtatct
cacaggaaattaggaatggctggccagaagttgggctcctccgctctcctgtgctacatc
cgccctgacactgccgatccagcaagtagctttagcttgactgtagccaatgttggcacg
tgccaagcagtcctgtgccgaggtgggaagccagtgcccctctctaaagtcttcagcctg
gagcaggacccagaggaggctcaaagggtgaaggaccaaaaagccatcatcacagaggac
aacaaagtgaatggggtaacctgctgtacccggatgctgggctgtacatacctctaccct
tggatcctccccaagccccacatatcttccactccgctgaccattcaagatgagttgctg
attctgggaaacaaagcattgtgggaacacttgtcctacacagaagctgtcaatgctgta
cgtcacgtacaagacccattagcagctgctaagaagctgtgcacattagcgcagagctat
ggctgtcaggacaatgtaggggcgatggtagtttatttgaatattggtgaggaaggctgc
acttgtgaaatgaatgggctcaccctcccaggtcctgtgggatttgcttcaaccaccact
atcaaggatgcccctaagccagccactccatcctctagcagtgggattgcctctgagttc
agcagtgagatgtccacctcagaggtgagcagtgaagtggggtccactgcttctgatgag
cataatgctgggggcctggacactgccttgcttccgaggccagagcggcgctgcagcctc
cacccaacacccacctctgggctgtttcagcgccagccttcttctgctaccttctccagt
aaccagtctgacaacggcctggacagtgatgatgaccagcccgttgagggggtcataacc
aatggcagcaaggtagaggtggaagtagacatccactgctgcagggggagggatctggag
aactcaccccctctcatagagagttctcctaccctgtgttctgaggaacatgctagaggg
tcgtgttttgggatccgaagacagaacagtgtgaatagtggcatgctcctgccaatgagc
aaggacaggatggagttacagaagtctccctccacctcctgcctctatgggaagaaactc
tccaatggctctattgtgcccctagaggacagcctgaacctcattgaagtggccacagaa
gtgcccaagaggaaaactggctattttgctgcccccactcagatggaaccagaggaccag
tttgttgtgcctcatgacctggaagaagaagtgaaggaacaaatgaaacagcaccaggac
agccggctcgagcctgagccccatgaagaggatcggaccgagcccccggaggagttcgac
acagcactatga

KEGG   Homo sapiens (human): 23239
Entry
23239             CDS       T01001                                 

Gene name
PHLPP1, PHLPP, PLEKHE1, PPM3A, SCOP
Definition
(RefSeq) PH domain and leucine rich repeat protein phosphatase 1
  KO
K16340  PH domain and leucine-rich repeat-containing protein phosphatase [EC:3.1.3.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    23239 (PHLPP1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23239 (PHLPP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     23239 (PHLPP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    23239 (PHLPP1)
SSDB
Motif
Pfam: LRR_8 PP2C LRR_4 LRR_6 PH
Other DBs
NCBI-GeneID: 23239
NCBI-ProteinID: NP_919431
OMIM: 609396
HGNC: 20610
Ensembl: ENSG00000081913
Vega: OTTHUMG00000150629
Pharos: O60346(Tchem)
UniProt: O60346
LinkDB
Position
18q21.33
AA seq 1717 aa
MEPAAAATVQRLPELGREDRASAPAAAAAAAAAAAAAAAALAAAAGGGRSPEPALTPAAP
SGGNGSGSGAREEAPGEAPPGPLPGRAGGAGRRRRRGAPQPIAGGAAPVPGAGGGANSLL
LRRGRLKRNLSAAAAAASSSSSSSAAAASHSPGAAGLPASCSASASLCTRSLDRKTLLLK
HRQTLQLQPSDRDWVRHQLQRGCVHVFDRHMASTYLRPVLCTLDTTAGEVAARLLQLGHK
GGGVVKVLGQGPGAAAAREPAEPPPEAGPRLAPPEPRDSEVPPARSAPGAFGGPPRAPPA
DLPLPVGGPGGWSRRASPAPSDSSPGEPFVGGPVSSPRAPRPVVSDTESFSLSPSAESVS
DRLDPYSSGGGSSSSSEELEADAASAPTGVPGQPRRPGHPAQPLPLPQTASSPQPQQKAP
RAIDSPGGAVREGSCEEKAAAAVAPGGLQSTPGRSGVTAEKAPPPPPPPTLYVQLHGETT
RRLEAEEKPLQIQNDYLFQLGFGELWRVQEEGMDSEIGCLIRFYAGKPHSTGSSERIQLS
GMYNVRKGKMQLPVNRWTRRQVILCGTCLIVSSVKDSLTGKMHVLPLIGGKVEEVKKHQH
CLAFSSSGPQSQTYYICFDTFTEYLRWLRQVSKVASQRISSVDLSCCSLEHLPANLFYSQ
DLTHLNLKQNFLRQNPSLPAARGLNELQRFTKLKSLNLSNNHLGDFPLAVCSIPTLAELN
VSCNALRSVPAAVGVMHNLQTFLLDGNFLQSLPAELENMKQLSYLGLSFNEFTDIPEVLE
KLTAVDKLCMSGNCVETLRLQALRKMPHIKHVDLRLNVIRKLIADEVDFLQHVTQLDLRD
NKLGDLDAMIFNNIEVLHCERNQLVTLDICGYFLKALYASSNELVQLDVYPVPNYLSYMD
VSRNRLENVPEWVCESRKLEVLDIGHNQICELPARLFCNSSLRKLLAGHNQLARLPERLE
RTSVEVLDVQHNQLLELPPNLLMKADSLRFLNASANKLESLPPATLSEETNSILQELYLT
NNSLTDKCVPLLTGHPHLKILHMAYNRLQSFPASKMAKLEELEEIDLSGNKLKAIPTTIM
NCRRMHTVIAHSNCIEVFPEVMQLPEIKCVDLSCNELSEVTLPENLPPKLQELDLTGNPR
LVLDHKTLELLNNIRCFKIDQPSTGDASGAPAVWSHGYTEASGVKNKLCVAALSVNNFCD
NREALYGVFDGDRNVEVPYLLQCTMSDILAEELQKTKNEEEYMVNTFIVMQRKLGTAGQK
LGGAAVLCHIKHDPVDPGGSFTLTSANVGKCQTVLCRNGKPLPLSRSYIMSCEEELKRIK
QHKAIITEDGKVNGVTESTRILGYTFLHPSVVPRPHVQSVLLTPQDEFFILGSKGLWDSL
SVEEAVEAVRNVPDALAAAKKLCTLAQSYGCHDSISAVVVQLSVTEDSFCCCELSAGGAV
PPPSPGIFPPSVNMVIKDRPSDGLGVPSSSSGMASEISSELSTSEMSSEVGSTASDEPPP
GALSENSPAYPSEQRCMLHPICLSNSFQRQLSSATFSSAFSDNGLDSDDEEPIEGVFTNG
SRVEVEVDIHCSRAKEKEKQQHLLQVPAEASDEGIVISANEDEPGLPRKADFSAVGTIGR
RRANGSVAPQERSHNVIEVATDAPLRKPGGYFAAPAQPDPDDQFIIPPELEEEVKEIMKH
HQEQQQQQQPPPPPQLQPQLPRHYQLDQLPDYYDTPL
NT seq 5154 nt   +upstreamnt  +downstreamnt
atggagcccgccgccgcggccacggtacagcgactccccgagctcggcagggaggaccga
gcttcggctccggcggccgccgctgcggcagcagcagcagcagcggcggccgcggcggct
ctggcggcggcggccgggggcggccggagtccggagcccgcgctgaccccggcggccccg
agcggcgggaacggcagcggcagcggggcgcgggaagaggccccaggcgaggcgccgccg
gggccgctgccgggcagagcggggggtgccgggcgcaggaggcggcgcggggcgccccag
cccattgccggcggggctgcccccgtacccggggccggcggcggcgccaactccctcctg
ctgaggagagggcggctgaagaggaatctgtccgcggccgccgcggccgcctcctcgtcg
tcgtcgtcctcggccgctgctgcctcgcactcccccggcgctgccggcctccccgcctcc
tgctcggcctcggcgtcgctgtgcacccggagcctggacaggaagacgctgcttctgaag
caccggcagacgctgcagctgcagccgtcggaccgggactgggtgaggcaccagctccag
cgcggctgcgtgcacgtcttcgaccgccacatggcctcgacctacctgcgcccggtgctc
tgcacactggacaccacggccggcgaggtggccgcccgcctgctgcagctgggccacaaa
ggcggcggcgtggtgaaggtgctgggccaggggcccggagccgccgccgcccgggagccc
gctgaaccgccccccgaggccggcccccggctggcgcccccggagccgcgggactcggag
gtaccgcccgcgaggagcgcgccgggtgccttcggggggcctccgcgcgcgccccccgcc
gacctacccctgcccgtcggcggcccgggcgggtggtcgcgccgcgccagcccagcgccc
tcggactccagccccggcgagccgttcgttgggggccctgtctcttcgccccgcgcccca
cggcctgtggtctccgacaccgagagcttcagtctgagtcccagcgccgagagcgtgtct
gaccggttggacccctacagcagcggcggcggctcctcgtcgtcgtcggaagagctcgag
gccgacgcagcctcggccccgacgggggtcccgggccagccccgccgtcccggccacccc
gcgcagcccctcccgcttccccagacggcttcctcgcctcagccgcagcagaaagccccg
agggccattgacagcccgggcggggccgtccgcgaggggtcgtgcgaggagaaggcagcg
gcagccgtggccccgggaggcctccagtctacccccgggaggagcggggtgaccgcggag
aaggcgcctccgccgcccccgccgcccaccctgtacgtgcagctccacggagagaccacc
cggcgcttggaggcggaggagaagccattgcagatccaaaatgactacctcttccaactg
ggatttggggagctgtggagggtgcaggaggaaggcatggactcggagattggctgcctc
atccgcttctatgcaggaaaacctcacagcacgggtagctctgaacggattcagctctca
ggaatgtataatgtccgtaaaggcaagatgcagttgccagtgaaccgatggacaagacgc
caagtcatcctatgtgggacctgcctgatagtatcatctgtgaaagacagcttgaccgga
aagatgcatgttctgccactaattggtggaaaagtagaagaagtgaaaaagcaccaacac
tgtttagcatttagctcctctggaccccaaagccagacttactacatttgctttgatact
ttcacagaatacttaaggtggctgcgacaagtctccaaggttgcatcccagcgcattagc
tcagtggacctctcgtgttgtagcctggaacatctgcctgccaacctcttctacagccaa
gacctcactcatctcaatttaaaacaaaacttcctaaggcagaaccctagccttccagct
gccagggggcttaatgaactgcaaaggttcaccaagttgaagagtcttaacctttccaat
aatcatttaggggacttcccactggcagtctgcagtattccaaccctggcagagctgaac
gtgtcctgcaatgccctgcgatcagtcccggcagccgttggagtgatgcacaacttacag
acatttttgttggatggaaactttctccaatcccttcctgctgagttggagaacatgaag
cagcttagttatctgggtctttctttcaatgaatttactgacattcccgaagtattggag
aaattgactgctgtggataaactttgtatgtctggaaactgtgtggagacccttaggcta
caggctttaagaaaaatgcctcacattaaacatgtggatctaaggttgaacgtaattagg
aagctgatagcagatgaagtggactttctacagcatgttactcagcttgacctacgagac
aataagcttggtgatctagatgctatgattttcaacaacattgaagttttacactgtgaa
aggaatcaactggtcacattagacatctgtggctatttcctaaaagcgctctatgcctct
tctaatgaacttgttcaacttgatgtttacccagttccaaattatctgtcctacatggat
gtttcaaggaaccgcttagaaaatgtgcctgagtgggtatgtgaaagccgaaagctagaa
gttttggatattggccataatcaaatatgtgaacttcctgcccgcttattttgtaatagc
agtctccggaaactactggcaggacacaaccagttggcaaggctgcctgaaaggctagaa
agaacctcggtggaggtcttggatgtgcaacacaaccagctccttgagctcccacctaac
cttctgatgaaggctgacagcctgagattcctgaacgcctctgcgaacaaactggaaagc
cttcctccagccacgctttccgaagagacaaacagtatcttacaagagttgtatttgaca
aataacagcctcacagacaaatgtgtgcccttgttaacgggacacccccatttgaagatc
cttcacatggcctataaccgacttcagagttttccagcaagtaaaatggcgaaactggag
gaacttgaagaaattgatctcagtgggaataagctgaaagccatcccaacaacgatcatg
aattgcaggcgcatgcacaccgtgattgctcactccaactgcatcgaggtctttcccgaa
gttatgcagctcccagagatcaagtgtgtggacctgagctgtaatgagctaagtgaagtc
acattaccagaaaacctgcctcccaaactgcaggagctagacctgactggaaacccgcgc
cttgtccttgatcacaaaaccctggaactactgaataatatccgctgtttcaagattgat
cagccttctacaggagacgcttccggagccccagctgtatggagtcatggttacactgaa
gcttcgggggtaaaaaacaagttgtgtgtcgcagccctgtcggtgaataacttctgtgac
aaccgcgaagccctgtatggtgtgtttgacggagaccggaatgtggaggtgccctacctt
ctccagtgcactatgagtgacattttggctgaagagctgcaaaaaacaaaaaacgaagaa
gaatacatggtcaatacattcattgtcatgcaaaggaaacttggaactgctgggcagaag
cttggtggtgccgctgtcctttgtcatatcaagcatgaccctgtggatccaggaggatcc
ttcaccttgacctctgctaatgtgggcaagtgccaaacagttctctgtcgaaatggaaag
ccgctgcctctgtccagatcttacatcatgagctgtgaagaagagctgaagaggattaaa
cagcacaaggccattatcactgaggatggcaaggtgaacggagtgactgagtccacgcgc
atcctgggctacaccttcctccatcccagtgtggtgcctcgcccccacgtgcagtccgtg
ctcctgactccccaggatgagttcttcatcctaggcagtaaggggttgtgggacagcctg
tccgtcgaggaggccgtggaagccgtgcgcaacgtgcccgatgccctggctgctgccaag
aagctgtgtaccctggcccagagctacggctgccacgacagcatcagcgctgtggtggtg
cagctcagtgtcactgaggacagcttctgctgctgcgagctcagcgccggtggggctgtg
ccaccacccagtcctggcatctttcctccctcagtgaacatggtgatcaaggatcggccc
tcagatgggctgggcgtgccgtcctccagcagcggcatggcttccgagattagcagtgag
ctctccacttctgagatgagcagcgaggtggggtcaacagcctccgatgagcccccgccc
ggagccctaagcgagaacagccctgcctaccccagtgagcagcgctgcatgctccacccc
atctgtctgtccaactccttccagcgccagctatccagcgccacgttctctagcgccttc
tccgacaacggccttgacagtgacgatgaggagcccatcgagggcgtcttcaccaacggc
agccgggtggaggtggaggtggacatccactgcagccgggccaaggagaaggagaaacag
cagcacctgcttcaggtgccagcagaggccagtgatgagggcattgtcatcagcgccaac
gaggatgagccaggtctgcccaggaaggcagacttctctgccgttgggaccattgggcgc
cggagggccaatggctctgttgcgccccaggaaaggagccacaatgtgatagaggtggct
acagacgcacctcttcgaaagcctggaggctattttgctgccccggctcagccggatcct
gatgatcagtttatcatacccccggagctggaagaggaggtcaaagaaatcatgaagcat
caccaggagcaacagcagcagcagcagccgccaccaccccctcagctccagccgcagctg
ccgcggcactaccagctggaccagctgccagattattacgacacgccactatga

DBGET integrated database retrieval system