KEGG   Homo sapiens (human): 2305Help
Entry
2305              CDS       T01001                                 

Gene name
FOXM1, FKHL16, FOXM1A, FOXM1B, FOXM1C, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TRIDENT
Definition
(RefSeq) forkhead box M1
  KO
K09406  forkhead box protein M
Organism
hsa  Homo sapiens (human)
Pathway
hsa04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    2305 (FOXM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2305 (FOXM1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2305 (FOXM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Forkhead
Motif
Other DBs
NCBI-GeneID: 2305
NCBI-ProteinID: NP_068772
OMIM: 602341
HGNC: 3818
Ensembl: ENSG00000111206
Vega: OTTHUMG00000168118
Pharos: Q08050(Tbio)
UniProt: Q08050 Q53Y49
LinkDB All DBs
Structure
PDB: 

Position
12p13.33
AA seq 763 aa AA seqDB search
MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEVAESNSCKFPA
GIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGSSGPNKFILISCGGAPTQPPG
LRPQTQTSYDAKRTEVTLETLGPKPAARDVNLPRPPGALCEQKRETCADGEAAGCTINNS
LSNIQWLRKMSSDGLGSRSIKQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYS
YMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELRRNMTIKTELP
LGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLPLAASLMSSELARHSKRVRIA
PKVLLAEEGIAPLSSAGPGKEEKLLFGEGFSPLLPVQTIKEEEIQPGEEMPHLARPIKVE
SPPLEEWPSPAPSFKEESSHSWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRE
RSRSRRKQHLLPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPLPDPLGLMDLS
TTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVPKPGSPEPQVSGLAANRSLTE
GLVLDTMNDSLSKILLDISFPGLDEDPLGPDNINWSQFIPELQ
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactagcccccgtcggccactgattctcaaaagacggaggctgccccttcctgtt
caaaatgccccaagtgaaacatcagaggaggaacctaagagatcccctgcccaacaggag
tctaatcaagcagaggcctccaaggaagtggcagagtccaactcttgcaagtttccagct
gggatcaagattattaaccaccccaccatgcccaacacgcaagtagtggccatccccaac
aatgctaatattcacagcatcatcacagcactgactgccaagggaaaagagagtggcagt
agtgggcccaacaaattcatcctcatcagctgtgggggagccccaactcagcctccagga
ctccggcctcaaacccaaaccagctatgatgccaaaaggacagaagtgaccctggagacc
ttgggaccaaaacctgcagctagggatgtgaatcttcctagaccacctggagccctttgc
gagcagaaacgggagacctgtgcagatggtgaggcagcaggctgcactatcaacaatagc
ctatccaacatccagtggcttcgaaagatgagttctgatggactgggctcccgcagcatc
aagcaagagatggaggaaaaggagaattgtcacctggagcagcgacaggttaaggttgag
gagccttcgagaccatcagcgtcctggcagaactctgtgtctgagcggccaccctactct
tacatggccatgatacaattcgccatcaacagcactgagaggaagcgcatgactttgaaa
gacatctatacgtggattgaggaccactttccctactttaagcacattgccaagccaggc
tggaagaactccatccgccacaacctttccctgcacgacatgtttgtccgggagacgtct
gccaatggcaaggtctccttctggaccattcaccccagtgccaaccgctacttgacattg
gaccaggtgtttaagccactggacccagggtctccacaattgcccgagcacttggaatca
cagcagaaacgaccgaatccagagctccgccggaacatgaccatcaaaaccgaactcccc
ctgggcgcacggcggaagatgaagccactgctaccacgggtcagctcatacctggtacct
atccagttcccggtgaaccagtcactggtgttgcagccctcggtgaaggtgccattgccc
ctggcggcttccctcatgagctcagagcttgcccgccatagcaagcgagtccgcattgcc
cccaaggtgctgctagctgaggaggggatagctcctctttcttctgcaggaccagggaaa
gaggagaaactcctgtttggagaagggttttctcctttgcttccagttcagactatcaag
gaggaagaaatccagcctggggaggaaatgccacacttagcgagacccatcaaagtggag
agccctcccttggaagagtggccctccccggccccatctttcaaagaggaatcatctcac
tcctgggaggattcgtcccaatctcccaccccaagacccaagaagtcctacagtgggctt
aggtccccaacccggtgtgtctcggaaatgcttgtgattcaacacagggagaggagggag
aggagccggtctcggagaaaacagcatctactgcctccctgtgtggatgagccggagctg
ctcttctcagaggggcccagtacttcccgctgggccgcagagctcccgttcccagcagac
tcctctgaccctgcctcccagctcagctactcccaggaagtgggaggaccttttaagaca
cccattaaggaaacgctgcccatctcctccaccccgagcaaatctgtcctccccagaacc
cctgaatcctggaggctcacgcccccagccaaagtagggggactggatttcagcccagta
caaacctcccagggtgcctctgaccccttgcctgaccccctggggctgatggatctcagc
accactcccttgcaaagtgctcccccccttgaatcaccgcaaaggctcctcagttcagaa
cccttagacctcatctccgtcccctttggcaactcttctccctcagatatagacgtcccc
aagccaggctccccggagccacaggtttctggccttgcagccaatcgttctctgacagaa
ggcctggtcctggacacaatgaatgacagcctcagcaagatcctgctggacatcagcttt
cctggcctggacgaggacccactgggccctgacaacatcaactggtcccagtttattcct
gagctacagtag

DBGET integrated database retrieval system