KEGG   Homo sapiens (human): 2308Help
Entry
2308              CDS       T01001                                 

Gene name
FOXO1, FKH1, FKHR, FOXO1A
Definition
(RefSeq) forkhead box O1
  KO
K07201  forkhead box protein O1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04068  FoxO signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04910  Insulin signaling pathway
hsa04919  Thyroid hormone signaling pathway
hsa04922  Glucagon signaling pathway
hsa04931  Insulin resistance
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05202  Transcriptional misregulation in cancer
hsa05215  Prostate cancer
Network
nt06240  Transcription
  Element
N00141  PAX3-FOXO1 fusion to transcriptional activation
Disease
H00037  Rhabdomyosarcoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    2308 (FOXO1)
   04152 AMPK signaling pathway
    2308 (FOXO1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    2308 (FOXO1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    2308 (FOXO1)
   04922 Glucagon signaling pathway
    2308 (FOXO1)
   04919 Thyroid hormone signaling pathway
    2308 (FOXO1)
  09149 Aging
   04211 Longevity regulating pathway
    2308 (FOXO1)
   04213 Longevity regulating pathway - multiple species
    2308 (FOXO1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2308 (FOXO1)
   05202 Transcriptional misregulation in cancer
    2308 (FOXO1)
  09162 Cancer: specific types
   05215 Prostate cancer
    2308 (FOXO1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    2308 (FOXO1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    2308 (FOXO1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    2308 (FOXO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2308 (FOXO1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2308 (FOXO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 2308
NCBI-ProteinID: NP_002006
OMIM: 136533
HGNC: 3819
Ensembl: ENSG00000150907
Vega: OTTHUMG00000016775
Pharos: Q12778(Tbio)
UniProt: Q12778
LinkDB All DBs
Structure
PDB: 

Position
13q14.11
AA seq 655 aa AA seqDB search
MAEAPQVVEIDPDFEPLPRPRSCTWPLPRPEFSQSNSATSSPAPSGSAAANPDAAAGLPS
ASAAAVSADFMSNLSLLEESEDFPQAPGSVAAAVAAAAAAAATGGLCGDFQGPEAGCLHP
APPQPPPPGPLSQHPPVPPAAAGPLAGQPRKSSSSRRNAWGNLSYADLITKAIESSAEKR
LTLSQIYEWMVKSVPYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSSWWMLN
PEGGKSGKSPRRRAASMDNNSKFAKSRSRAAKKKASLQSGQEGAGDSPGSQFSKWPASPG
SHSNDDFDNWSTFRPRTSSNASTISGRLSPIMTEQDDLGEGDVHSMVYPPSAAKMASTLP
SLSEISNPENMENLLDNLNLLSSPTSLTVSTQSSPGTMMQQTPCYSFAPPNTSLNSPSPN
YQKYTYGQSSMSPLPQMPIQTLQDNKSSYGGMSQYNCAPGLLKELLTSDSPPHNDIMTPV
DPGVAQPNSRVLGQNVMMGPNSVMSTYGSQASHNKMMNPSSHTHPGHAQQTSAVNGRPLP
HTVSTMPHTSGMNRLTQVKTPVQVPLPHPMQMSALGGYSSVSSCNGYGRMGLLHQEKLPS
DLDGMFIERLDCDMESIIRNDLMDGDTLDFNFDNVLPNQSFPHSVKTTTHSWVSG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggcgcctcaggtggtggagatcgacccggacttcgagccgctgccccggccg
cgctcgtgcacctggccgctgcccaggccggagtttagccagtccaactcggccacctcc
agcccggcgccgtcgggcagcgcggctgccaaccccgacgccgcggcgggcctgccctcg
gcctcggctgccgctgtcagcgccgacttcatgagcaacctgagcttgctggaggagagc
gaggacttcccgcaggcgcccggctccgtggcggcggcggtggcggcggcggccgccgcg
gccgccaccggggggctgtgcggggacttccagggcccggaggcgggctgcctgcaccca
gcgccaccgcagcccccgccgcccgggccgctgtcgcagcacccgccggtgccccccgcc
gccgctgggccgctcgcggggcagccgcgcaagagcagctcgtcccgccgcaacgcgtgg
ggcaacctgtcctacgccgacctcatcaccaaggccatcgagagctcggcggagaagcgg
ctcacgctgtcgcagatctacgagtggatggtcaagagcgtgccctacttcaaggataag
ggtgacagcaacagctcggcgggctggaagaattcaattcgtcataatctgtccctacac
agcaagttcattcgtgtgcagaatgaaggaactggaaaaagttcttggtggatgctcaat
ccagagggtggcaagagcgggaaatctcctaggagaagagctgcatccatggacaacaac
agtaaatttgctaagagccgaagccgagctgccaagaagaaagcatctctccagtctggc
caggagggtgctggggacagccctggatcacagttttccaaatggcctgcaagccctggc
tctcacagcaatgatgactttgataactggagtacatttcgccctcgaactagctcaaat
gctagtactattagtgggagactctcacccattatgaccgaacaggatgatcttggagaa
ggggatgtgcattctatggtgtacccgccatctgccgcaaagatggcctctactttaccc
agtctgtctgagataagcaatcccgaaaacatggaaaatcttttggataatctcaacctt
ctctcatcaccaacatcattaactgtttcgacccagtcctcacctggcaccatgatgcag
cagacgccgtgctactcgtttgcgccaccaaacaccagtttgaattcacccagcccaaac
taccaaaaatatacatatggccaatccagcatgagccctttgccccagatgcctatacaa
acacttcaggacaataagtcgagttatggaggtatgagtcagtataactgtgcgcctgga
ctcttgaaggagttgctgacttctgactctcctccccataatgacattatgacaccagtt
gatcctggggtagcccagcccaacagccgggttctgggccagaacgtcatgatgggccct
aattcggtcatgtcaacctatggcagccaggcatctcataacaaaatgatgaatcccagc
tcccatacccaccctggacatgctcagcagacatctgcagttaacgggcgtcccctgccc
cacacggtaagcaccatgccccacacctcgggtatgaaccgcctgacccaagtgaagaca
cctgtacaagtgcctctgccccaccccatgcagatgagtgccctggggggctactcctcc
gtgagcagctgcaatggctatggcagaatgggccttctccaccaggagaagctcccaagt
gacttggatggcatgttcattgagcgcttagactgtgacatggaatccatcattcggaat
gacctcatggatggagatacattggattttaactttgacaatgtgttgcccaaccaaagc
ttcccacacagtgtcaagacaacgacacatagctgggtgtcaggctga

KEGG   Homo sapiens (human): 2309Help
Entry
2309              CDS       T01001                                 

Gene name
FOXO3, AF6q21, FKHRL1, FKHRL1P2, FOXO2, FOXO3A
Definition
(RefSeq) forkhead box O3
  KO
K09408  forkhead box protein O3
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04062  Chemokine signaling pathway
hsa04068  FoxO signaling pathway
hsa04137  Mitophagy - animal
hsa04151  PI3K-Akt signaling pathway
hsa04152  AMPK signaling pathway
hsa04211  Longevity regulating pathway
hsa04213  Longevity regulating pathway - multiple species
hsa04218  Cellular senescence
hsa04722  Neurotrophin signaling pathway
hsa04917  Prolactin signaling pathway
hsa05213  Endometrial cancer
hsa05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    2309 (FOXO3)
   04151 PI3K-Akt signaling pathway
    2309 (FOXO3)
   04152 AMPK signaling pathway
    2309 (FOXO3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    2309 (FOXO3)
  09143 Cell growth and death
   04218 Cellular senescence
    2309 (FOXO3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    2309 (FOXO3)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    2309 (FOXO3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    2309 (FOXO3)
  09149 Aging
   04211 Longevity regulating pathway
    2309 (FOXO3)
   04213 Longevity regulating pathway - multiple species
    2309 (FOXO3)
 09160 Human Diseases
  09162 Cancer: specific types
   05213 Endometrial cancer
    2309 (FOXO3)
   05223 Non-small cell lung cancer
    2309 (FOXO3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    2309 (FOXO3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2309 (FOXO3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Fork head/winged helix other regulators
    2309 (FOXO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FOXO_KIX_bdg Forkhead FOXO-TAD
Motif
Other DBs
NCBI-GeneID: 2309
NCBI-ProteinID: NP_001446
OMIM: 602681
HGNC: 3821
Ensembl: ENSG00000118689
Vega: OTTHUMG00000015327
Pharos: O43524(Tbio)
UniProt: O43524
LinkDB All DBs
Structure
PDB: 

Position
6q21
AA seq 673 aa AA seqDB search
MAEAPASPAPLSPLEVELDPEFEPQSRPRSCTWPLQRPELQASPAKPSGETAADSMIPEE
EDDEDDEDGGGRAGSAMAIGGGGGSGTLGSGLLLEDSARVLAPGGQDPGSGPATAAGGLS
GGTQALLQPQQPLPPPQPGAAGGSGQPRKCSSRRNAWGNLSYADLITRAIESSPDKRLTL
SQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDG
GKSGKAPRRRAVSMDNSNKYTKSRGRAAKKKAALQTAPESADDSPSQLSKWPGSPTSRSS
DELDAWTDFRSRTNSNASTVSGRLSPIMASTELDEVQDDDAPLSPMLYSSSASLSPSVSK
PCTVELPRLTDMAGTMNLNDGLTENLMDDLLDNITLPPSQPSPTGGLMQRSSSFPYTTKG
SGLGSPTSSFNSTVFGPSSLNSLRQSPMQTIQENKPATFSSMSHYGNQTLQDLLTSDSLS
HSDVMMTQSDPLMSQASTAVSAQNSRRNVMLRNDPMMSFAAQPNQGSLVNQNLLHHQHQT
QGALGGSRALSNSVSNMGLSESSSLGSAKHQQQSPVSQSMQTLSDSLSGSSLYSTSANLP
VMGHEKFPSDLDLDMFNGSLECDMESIIRSELMDADGLDFNFDSLISTQNVVGLNVGNFT
GAKQASSQSWVPG
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggcaccggcttccccggccccgctctctccgctcgaagtggagctggacccg
gagttcgagccccagagccgtccgcgatcctgtacgtggcccctgcaaaggccggagctc
caagcgagccctgccaagccctcgggggagacggccgccgactccatgatccccgaggag
gaggacgatgaagacgacgaggacggcgggggacgggccggctcggccatggcgatcggc
ggcggcggcgggagcggcacgctgggctccgggctgctccttgaggactcggcccgggtg
ctggcacccggagggcaagaccccgggtctgggccagccaccgcggcgggcgggctgagc
gggggtacacaggcgctgctgcagcctcagcaaccgctgccaccgccgcagccgggggcg
gctgggggctccgggcagccgaggaaatgttcgtcgcggcggaacgcctggggaaacctg
tcctacgcggacctgatcacccgcgccatcgagagctccccggacaaacggctcactctg
tcccagatctacgagtggatggtgcgttgcgtgccctacttcaaggataagggcgacagc
aacagctctgccggctggaagaactccatccggcacaacctgtcactgcatagtcgattc
atgcgggtccagaatgagggaactggcaagagctcttggtggatcatcaaccctgatggg
gggaagagcggaaaagccccccggcggcgggctgtctccatggacaatagcaacaagtat
accaagagccgtggccgcgcagccaagaagaaggcagccctgcagacagcccccgaatca
gctgacgacagtccctcccagctctccaagtggcctggcagccccacgtcacgcagcagt
gatgagctggatgcgtggacggacttccgttcacgcaccaattctaacgccagcacagtc
agtggccgcctgtcgcccatcatggcaagcacagagttggatgaagtccaggacgatgat
gcgcctctctcgcccatgctctacagcagctcagccagcctgtcaccttcagtaagcaag
ccgtgcacggtggaactgccacggctgactgatatggcaggcaccatgaatctgaatgat
gggctgactgaaaacctcatggacgacctgctggataacatcacgctcccgccatcccag
ccatcgcccactgggggactcatgcagcggagctctagcttcccgtataccaccaagggc
tcgggcctgggctccccaaccagctcctttaacagcacggtgttcggaccttcatctctg
aactccctacgccagtctcccatgcagaccatccaagagaacaagccagctaccttctct
tccatgtcacactatggtaaccagacactccaggacctgctcacttcggactcacttagc
cacagcgatgtcatgatgacacagtcggaccccttgatgtctcaggccagcaccgctgtg
tctgcccagaattcccgccggaacgtgatgcttcgcaatgatccgatgatgtcctttgct
gcccagcctaaccagggaagtttggtcaatcagaacttgctccaccaccagcaccaaacc
cagggcgctcttggtggcagccgtgccttgtcgaattctgtcagcaacatgggcttgagt
gagtccagcagccttgggtcagccaaacaccagcagcagtctcctgtcagccagtctatg
caaaccctctcggactctctctcaggctcctccttgtactcaactagtgcaaacctgccc
gtcatgggccatgagaagttccccagcgacttggacctggacatgttcaatgggagcttg
gaatgtgacatggagtccattatccgtagtgaactcatggatgctgatgggttggatttt
aactttgattccctcatctccacacagaatgttgttggtttgaacgtggggaacttcact
ggtgctaagcaggcctcatctcagagctgggtgccaggctga

DBGET integrated database retrieval system