KEGG   Homo sapiens (human): 23082
Entry
23082             CDS       T01001                                 

Gene name
PPRC1, PRC
Definition
(RefSeq) PPARG related coactivator 1
  KO
K17963  peroxisome proliferator-activated receptor gamma coactivator-related protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23082 (PPRC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    23082 (PPRC1)
SSDB
Motif
Pfam: RRM_1
Other DBs
NCBI-GeneID: 23082
NCBI-ProteinID: NP_055877
OMIM: 617462
HGNC: 30025
Ensembl: ENSG00000148840
Vega: OTTHUMG00000018948
Pharos: Q5VV67(Tbio)
UniProt: Q5VV67
LinkDB
Position
10q24.32
AA seq 1664 aa
MAARRGRRDGVAPPPSGGPGPDPGGGARGSGWGSRSQAPYGTLGAVSGGEQVLLHEEAGD
SGFVSLSRLGPSLRDKDLEMEELMLQDETLLGTMQSYMDASLISLIEDFGSLGESRLSLE
DQNEVSLLTALTEILDNADSENLSPFDSIPDSELLVSPREGSSLHKLLTLSRTPPERDLI
TPVDPLGPSTGSSRGSGVEMSLPDPSWDFSPPSFLETSSPKLPSWRPPRSRPRWGQSPPP
QQRSDGEEEEEVASFSGQILAGELDNCVSSIPDFPMHLACPEEEDKATAAEMAVPAAGDE
SISSLSELVRAMHPYCLPNLTHLASLEDELQEQPDDLTLPEGCVVLEIVGQAATAGDDLE
IPVVVRQVSPGPRPVLLDDSLETSSALQLLMPTLESETEAAVPKVTLCSEKEGLSLNSEE
KLDSACLLKPREVVEPVVPKEPQNPPANAAPGSQRARKGRKKKSKEQPAACVEGYARRLR
SSSRGQSTVGTEVTSQVDNLQKQPQEELQKESGPLQGKGKPRAWARAWAAALENSSPKNL
ERSAGQSSPAKEGPLDLYPKLADTIQTNPIPTHLSLVDSAQASPMPVDSVEADPTAVGPV
LAGPVPVDPGLVDLASTSSELVEPLPAEPVLINPVLADSAAVDPAVVPISDNLPPVDAVP
SGPAPVDLALVDPVPNDLTPVDPVLVKSRPTDPRRGAVSSALGGSAPQLLVESESLDPPK
TIIPEVKEVVDSLKIESGTSATTHEARPRPLSLSEYRRRRQQRQAETEERSPQPPTGKWP
SLPETPTGLADIPCLVIPPAPAKKTALQRSPETPLEICLVPVGPSPASPSPEPPVSKPVA
SSPTEQVPSQEMPLLARPSPPVQSVSPAVPTPPSMSAALPFPAGGLGMPPSLPPPPLQPP
SLPLSMGPVLPDPFTHYAPLPSWPCYPHVSPSGYPCLPPPPTVPLVSGTPGAYAVPPTCS
VPWAPPPAPVSPYSSTCTYGPLGWGPGPQHAPFWSTVPPPPLPPASIGRAVPQPKMESRG
TPAGPPENVLPLSMAPPLSLGLPGHGAPQTEPTKVEVKPVPASPHPKHKVSALVQSPQMK
ALACVSAEGVTVEEPASERLKPETQETRPREKPPLPATKAVPTPRQSTVPKLPAVHPARL
RKLSFLPTPRTQGSEDVVQAFISEIGIEASDLSSLLEQFEKSEAKKECPPPAPADSLAVG
NSGGVDIPQEKRPLDRLQAPELANVAGLTPPATPPHQLWKPLAAVSLLAKAKSPKSTAQE
GTLKPEGVTEAKHPAAVRLQEGVHGPSRVHVGSGDHDYCVRSRTPPKKMPALVIPEVGSR
WNVKRHQDITIKPVLSLGPAAPPPPCIAASREPLDHRTSSEQADPSAPCLAPSSLLSPEA
SPCRNDMNTRTPPEPSAKQRSMRCYRKACRSASPSSQGWQGRRGRNSRSVSSGSNRTSEA
SSSSSSSSSSSRSRSRSLSPPHKRWRRSSCSSSGRSRRCSSSSSSSSSSSSSSSSSSSSR
SRSRSPSPRRRSDRRRRYSSYRSHDHYQRQRVLQKERAIEERRVVFIGKIPGRMTRSELK
QRFSVFGEIEECTIHFRVQGDNYGFVTYRYAEEAFAAIESGHKLRQADEQPFDLCFGGRR
QFCKRSYSDLDSNREDFDPAPVKSKFDSLDFDTLLKQAQKNLRR
NT seq 4995 nt   +upstreamnt  +downstreamnt
atggcggcgcgccggggacggagagacggagtcgcgccgcccccgagtgggggccccggt
ccggaccctggcgggggagcccgcggcagtggttggggaagtcgaagccaagcgccgtat
gggactttgggcgctgtgagcggcggcgagcaggtgctgctgcatgaggaggcgggtgat
tctggctttgtcagtctctctcggctgggcccatctctgagggacaaggacctggaaatg
gaggagctaatgctgcaggatgagacactgctggggaccatgcagagctacatggatgcc
tcccttatctccctcattgaggattttgggagccttggagagagcaggttatctctggag
gaccagaatgaagtgtcgctgctcacggctctgacggagatcttggacaatgcagattct
gagaacctttctccatttgacagcattcctgattcggagctgcttgtgtcaccccgggag
ggctcctctctgcacaagctgcttactctctctcggacacccccagaacgtgacctcatc
accccagttgacccactggggcccagtacaggcagcagtagagggagtggggttgaaatg
tctcttccagatccctcttgggacttctccccaccctctttcttagagacctcttccccc
aagcttcctagctggagacccccaagatcaagaccacgctggggccaatccccacctccc
cagcagcgcagtgatggagaagaagaggaggaggtggccagcttcagtggccagattctt
gccggggagcttgacaactgtgtgagcagtatcccggacttccccatgcatttggcctgc
cctgaggaggaagataaagcaacagcagcagagatggcagtgccagcagctggtgatgag
agcatctcctccctgagtgagctggtgcgggccatgcacccatactgcctgcccaacctc
acccacctggcatcacttgaggatgagcttcaggagcagccagatgatttgacactgcct
gagggctgcgtagtgctggagattgtggggcaggcagccacagctggcgatgacctggag
atcccagttgtggtgcgacaggtctctcctggaccccggcctgtgctcctggatgactcg
ctagagactagttctgccttgcagctgcttatgcctacactggagtcagagacagaggct
gctgtgcccaaggtaaccctctgctctgagaaagaggggttgtcattgaactcagaggag
aagctggactcagcctgcttattgaagcccagggaggtcgtggagccggtggtgcccaag
gagcctcagaacccacctgccaatgcagcaccaggttcccagagagctcgaaagggcagg
aagaagaagagcaaggagcagccagcagcctgtgtggaaggctatgccaggaggctgagg
tcatcttctcgcgggcagtctactgtaggtacagaagtgacctctcaggtagacaacttg
cagaaacagcctcaggaagaacttcaaaaagagtctgggcctctccagggtaaggggaag
ccccgggcttgggctcgggcctgggcagctgccttggagaattctagccctaagaacttg
gagagaagtgctggacaaagtagtcctgctaaagaaggccctctagacctctacccaaag
ctggctgacactatccaaaccaatcctataccaacccatctctcattggtcgactctgcc
caagccagccccatgccagttgactctgttgaagctgatcccactgcagttggccctgtt
ctagctggccctgtacctgttgaccctgggttggttgaccttgcttcaaccagctcagaa
ctggttgagcctctcccggctgagccagtgctgatcaacccagtcctggctgactcagca
gcagttgaccctgcagtggttcccatctcagataacttgccaccagttgatgctgtcccg
tctggcccagcaccagttgatctagcactggttgaccctgttcctaatgacctgactcca
gttgacccagtgctagttaagtccagaccaactgatcccagacgtggtgcagtgtcatca
gccctggggggttcagcaccccagctcctcgtggagtcagagtccttggacccaccaaag
accatcatccctgaagtcaaagaggttgtggattctctgaaaattgaaagtggtaccagt
gctacaacccatgaagccagacctcggcctctcagcttatctgagtaccggcgacgaagg
cagcaacgccaagcagaaacagaagagagaagtccacagcccccaactgggaagtggcct
agccttccagagactcccacagggctggcagacatcccttgtcttgtcatcccaccagcc
ccagccaagaagacagctctgcagagaagccctgaaacaccccttgagatttgccttgtg
cctgtaggtcccagccctgcttctcctagtcctgagccacctgtaagcaaacctgtggcc
tcatctcccactgagcaggtgccatcccaggagatgccactgttggcgagaccttcccct
cctgtgcagtctgtgtcccctgctgtgcccacacctccctcgatgtctgctgccctgcct
ttccctgcaggtgggcttggcatgccccccagtctgcccccacctcccttgcagcctcct
agtcttccattgtctatggggccagtactacctgatccgtttactcactatgcccccttg
ccatcctggccttgttatcctcatgtgtccccttctggctatccttgcctgcccccccca
ccaacggtgcccctagtgtctggtactcctggtgcctatgccgtgcctcccacttgcagt
gtgccttgggcaccccctcctgccccagtctcaccttacagttccacatgtacctatggg
cccttgggatggggcccagggcctcaacatgctccattctggtctactgttcccccacct
cctttgcctccagcctccattgggagagctgttccccaacctaaaatggagtctaggggc
actccagctggccctcctgaaaatgtacttcccttgtcgatggctcctcccctcagtctt
gggctacctggccatggagctcctcagacagagcctaccaaggtggaggtcaagccagtg
cctgcatctccccatccgaaacacaaggtgtctgccctggtgcaaagtccccagatgaag
gctctagcatgtgtgtctgctgaaggtgtgactgttgaggagcctgcatcagagaggcta
aagcctgagacccaagagaccaggcccagggagaagccccccttgcctgctaccaaggct
gttcccacaccaaggcagagcactgtccccaagctgcctgctgtccacccagcccgtcta
aggaagctgtccttcctgcctaccccacgtactcagggttctgaagatgtggtacaggct
ttcatcagtgagattggaattgaggcatcggacctgtccagtctgctggagcagtttgag
aaatcagaagccaaaaaggagtgtcctcctccggctcctgctgacagcttggctgtagga
aactcaggcggcgttgacattccccaggagaagaggcccctagaccggttacaagcccca
gaactggccaacgtggcagggctcacccctccagctacccctccccaccagttatggaag
cccctggctgctgtctcactgctggccaaagccaaatctcctaagtccaccgcccaggag
ggaaccctgaagcctgaaggagttacggaggccaaacatccagctgcagttcgcctccaa
gaaggggtccatggccctagtcgagtccatgtgggctctggggaccatgactattgtgtc
cggagcaggacccccccaaaaaagatgcctgccctagtcattccagaggtgggctcccga
tggaatgtcaagcgccatcaggacatcaccatcaaacctgtcttgtccttgggcccagct
gcccctccgcccccatgcatagctgcctcccgggagccgcttgatcacaggactagcagt
gagcaggcagatccctcagcaccctgccttgccccatccagcttgctgtcccctgaggcc
tcaccctgccggaatgacatgaacactaggactccccctgaaccctcagccaagcagcgg
tcaatgcgctgttaccgaaaagcctgcaggtcagccagcccctcaagccagggctggcag
ggccgccgaggccgcaacagccgttctgtcagctctgggtccaaccggactagcgaagca
tcttcctcatcctcatcatcgtcttcctcatcccgatctcggtccaggtccctctccccc
ccacacaagaggtggcgaaggtccagctgtagttcctctggacgttctcgaagatgctct
tcctcttcttcgtcatcatcttcctcttcgtcttcctcatcctcatcatccagttctcga
agccgctcacgatccccatccccccgccggagaagtgacaggaggcggcggtacagctct
tatcgttcacatgaccattaccaaaggcaaagagtgctacaaaaggagcgtgcaatagaa
gaaagaagggtggtcttcattggaaagatacctggccgcatgactcgatcagagctgaaa
cagaggttctccgtttttggagagattgaggagtgcaccatccacttccgtgtccaaggg
gacaactacggcttcgtcacttatcgctatgctgaggaggcatttgcagccattgagagt
ggccacaagctgcggcaggcagatgagcagccctttgatctctgctttgggggccgaagg
cagttctgcaagaggagctattctgatcttgactccaaccgggaagactttgacccagca
cctgtaaagagcaaatttgattctcttgactttgacacattgttgaaacaggcccagaag
aacctcaggaggtaa

DBGET integrated database retrieval system