KEGG   Homo sapiens (human): 23094Help
Entry
23094             CDS       T01001                                 

Gene name
SIPA1L3, CTRCT45, SPAL3, SPAR3
Definition
(RefSeq) signal induced proliferation associated 1 like 3
  KO
K17703  signal-induced proliferation-associated 1 like protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
Disease
H01202  Cataract
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    23094 (SIPA1L3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SPAR_C Rap_GAP PDZ PDZ_6 HAUS-augmin3 CENP-K
Motif
Other DBs
NCBI-GeneID: 23094
NCBI-ProteinID: NP_055888
OMIM: 616655
HGNC: 23801
Ensembl: ENSG00000105738
Vega: OTTHUMG00000073727
Pharos: O60292(Tbio)
UniProt: O60292 B2RWP0
LinkDB All DBs
Position
19q13.13-q13.2
AA seq 1781 aa AA seqDB search
MTTYRAIPSDGVDLAASCGARVGDVLPGPHTGDYAPLGFWAQNGSMSQPLGESPATATAT
ATATTRPSPTTPAMPKMGVRARVADWPPKREALREHSNPSPSQDTDGTKATKMAHSMRSI
QNGQPPTSTPASSGSKAFHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSEITLSECD
AEDAGEPRGARHTGALPLFREYGSTSSIDVQGMPEQSFFDILNEFRSEQPDARGCQALTE
LLRADPGPHLMGGGGGAKGDSHNGQPAKDSLLPLQPTKEKEKARKKPARGLGGGDTVDSS
IFRKLRSSKPEGEAGRSPGEADEGRSPPEASRPWVCQKSFAHFDVQSMLFDLNEAAANRV
SVSQRRNTTTGASAASAASAMASLTASRAHSLGGLDPAFTSTEDLNCKENLEQDLGDDNS
NDLLLSCPHFRNEIGGECERNVSFSRASVGSPSSGEGHLAEPALSAYRTNASISVLEVPK
EQQRTQSRPRQYSIEHVDLGARYYQDYFVGKEHANYFGVDEKLGPVAVSIKREKLEDHKE
HGPQYQYRIIFRTRELITLRGSILEDATPTATKHGTGRGLPLKDALEYVIPELNIHCLRL
ALNTPKVTEQLLKLDEQGLCRKHKVGILYCKAGQSSEEEMYNNEEAGPAFEEFLSLIGEK
VCLKGFTKYAAQLDVKTDSTGTHSLYTMYQDYEIMFHVSTLLPYTPNNRQQLLRKRHIGN
DIVTIIFQEPGALPFTPKNIRSHFQHVFIIVRVHNPCTDNVCYSMAVTRSKDAPPFGPPI
PSGTTFRKSDVFRDFLLAKVINAENAAHKSDKFHTMATRTRQEYLKDLAENCVSNTPIDS
TGKFNLISLTSKKKEKTKARAGAEQHSAGAIAWRVVAQDYAQGVEIDCILGISNEFVVLL
DLRTKEVVFNCYCGDVIGWTPDSSTLKIFYGRGDHIFLQATEGSVEDIREIVQRLKVMTS
GWETVDMTLRRNGLGQLGFHVKYDGTVAEVEDYGFAWQAGLRQGSRLVEICKVAVVTLTH
DQMIDLLRTSVTVKVVIIPPFEDGTPRRGWPETYDMNTSEPKTEQESITPGGRPPYRSNA
PWQWSGPASHNSLPASKWATPTTPGHAQSLSRPLKQTPIVPFRESQPLHSKRPVSFPETP
YTVSPAGADRVPPYRQPSGSFSTPGSATYVRYKPSPERYTAAPHPLLSLDPHFSHDGTSS
GDSSSGGLTSQESTMERQKPEPLWHVPAQARLSAIAGSSGNKHPSRQDAAGKDSPNRHSK
GEPQYSSHSSSNTLSSNASSSHSDDRWFDPLDPLEPEQDPLSKGGSSDSGIDTTLYTSSP
SCMSLAKAPRPAKPHKPPGSMGLCGGGREAAGRSHHADRRREVSPAPAVAGQSKGYRPKL
YSSGSSTPTGLAGGSRDPPRQPSDMGSRVGYPAQVYKTASAETPRPSQLAQPSPFQLSAS
VPKSFFSKQPVRNKHPTGWKRTEEPPPRPLPFSDPKKQVDTNTKNVFGQPRLRASLRDLR
SPRKNYKSTIEDDLKKLIIMDNLGPEQERDTGQSPQKGLQRTLSDESLCSGRREPSFASP
AGLEPGLPSDVLFTSTCAFPSSTLPARRQHQHPHPPVGPGATPAAGSGFPEKKSTISASE
LSLADGRDRPLRRLDPGLMPLPDTAAGLEWSSLVNAAKAYEVQRAVSLFSLNDPALSPDI
PPAHSPVHSHLSLERGPPTPRTTPTMSEEPPLDLTGKVYQLEVMLKQLHTDLQKEKQDKV
VLQSEVASLRQNNQRLQEESQAASEQLRKFAEIFCREKKEL
NT seq 5346 nt NT seq  +upstreamnt  +downstreamnt
atgaccacctatcgggccatccccagcgatggtgtggacctggcagccagctgtggcgcc
agggtgggcgatgtcctccctgggccacacacaggggactacgctcccttgggattctgg
gcccagaatggcagcatgtcccagcctcttggcgagagcccggccaccgccaccgccacc
gccaccgccaccacccgccccagccccaccactcccgcaatgcccaagatgggcgtgcgc
gcaagggtggccgactggccgcccaagcgggaggccctgagagagcacagcaacccaagc
ccctcccaggacacagatggcacaaaggccaccaagatggcccattccatgaggagcata
cagaacggacagccccccaccagcaccccggcttcctcagggtccaaagccttccaccga
ctctccaggagaaggtccaaagacgtggagttccaggacgggtggccccggtcccccggc
agggccttcctcccccttcggcaccgcagcagcagcgagatcaccctcagcgagtgtgac
gcggaggacgcgggggagccgcggggggcccggcacacgggggcgctgcccctcttccgc
gagtacgggagcacctcgtccatcgacgtgcagggcatgcccgagcagagcttcttcgac
atcctgaacgagttccgcagcgagcagcccgacgcccgagggtgccaggccctcaccgag
ctcctccgggcagatcctggcccacacctcatggggggcggcggcggagccaagggggac
tcccacaacgggcagcccgccaaggacagcctcctgccactgcagcccacgaaggagaag
gagaaggcccggaagaaacctgcgcggggcctcggcggcggggacacggtggactcgtcc
atctttcggaagctaaggagcagcaaacccgagggggaggctgggcgttccccgggggag
gccgacgagggccggagccccccggaagccagcaggccgtgggtgtgtcagaagagcttc
gcccacttcgacgtgcagagcatgctgttcgacctcaacgaggcggccgccaacagggtg
tcggtgtcgcagcggcggaacaccaccacgggtgcttcggccgcttccgccgcctcggcc
atggcctccctcacggcctcgcgggcccacagcctcggaggcctggacccggccttcacc
agcacagaggacctaaactgcaaggagaacttggagcaggacctcggcgatgacaacagc
aacgacctgctgctcagctgcccgcacttccgcaatgagatcgggggcgagtgtgagcgc
aacgtgagcttctcccgggcttccgtgggctccccgagcagcggcgagggccacctggca
gagcccgccctgagcgcctaccgcaccaacgccagcatctcggtgttggaagttcccaag
gagcagcagcggacgcagagtcggccccggcagtacagcatcgagcatgtggacctgggc
gcccgctactaccaggattacttcgtgggcaaagaacatgccaattacttcggcgtggat
gagaagctggggccagtggctgtgagcattaagcgggagaagctggaagaccacaaggag
cacggacctcagtaccagtacaggatcatcttccggacccgcgagctcatcaccctgcgg
ggctccatcctggaagatgctacgcccacagccaccaagcatgggaccgggcggggcctg
cccttgaaggatgccctggagtatgtcatccccgagctcaacatccactgcctgcggctg
gccctcaacacccccaaggtgacggagcaactgctgaagctcgatgagcaagggctctgc
cggaagcacaaggtgggcatcctctattgcaaggccggccagagctccgaggaggagatg
tacaacaatgaggaggccggccccgcctttgaggagttcctctccctcatcggcgagaag
gtctgcctgaagggcttcaccaagtacgctgcccagctggacgtcaagaccgactccacg
ggaacccactccctctacacgatgtaccaggactacgagatcatgttccatgtctccacc
ctgctcccttacacccccaacaacaggcagcagctgctacggaagaggcacataggaaat
gacatcgtgacgatcatcttccaggagcctggcgcgctaccgttcacccccaagaacatc
cgctcccacttccagcacgtcttcatcattgtccgagtccacaacccctgcactgataac
gtctgttacagtatggctgtgacccgatccaaagacgctcctcctttcggcccccccatc
cccagtggaaccacattccgcaaatccgacgtcttcagagacttcttgctggccaaggtg
attaacgctgagaacgccgcgcacaagtccgacaagttccacaccatggccaccaggacc
cgccaggagtatctcaaggacctggccgaaaactgtgtctccaacacccccatcgactcc
accggcaaattcaacctcatctccctgacctccaagaagaaggaaaagacaaaagcacgg
gctggcgctgagcagcacagtgcaggggccatcgcctggagggtggtggcccaggactac
gcccagggggtggaaatcgactgcattttgggaatttccaatgagtttgtggtgctcctg
gacttacgcaccaaggaggtggtgttcaactgctactgcggggatgtcattggctggact
ccagactcctccacactcaaaatcttctatggacgaggagaccacatcttcctacaggcg
acagagggttctgtggaggacataagggagatagtgcagagactgaaggtgatgaccagt
ggctgggagacggtggacatgacgcttcggcggaacgggctcgggcagctgggcttccac
gtgaagtacgacggcacggtggccgaggttgaggactatgggttcgcctggcaggccggc
ctccggcagggcagccgactagtggagatctgcaaggtggccgtggtcacactgacccac
gaccagatgatcgacctgctgcgcacctctgtcactgtgaaggtggtcatcatcccgcct
tttgaggacggcactccccggaggggttggccggagacctacgacatgaatacctcggag
cccaagacggagcaggaaagcatcactcctgggggccggcccccctaccgcagcaatgct
ccctggcagtggagcgggcccgcatcccataactctctaccagcctccaagtgggccact
ccaaccactcccggccatgcccagtccctgagccggcccctgaagcagacccccatagtc
cccttccgggagtcccagccactgcacagcaagaggcctgtcagcttcccagaaacccct
tacacagtatcaccagcaggggccgacagagtccctccctaccgacagccttctgggagc
ttctccacccccggttcggccacctacgtgagatacaagccatccccagaaaggtacacg
gctgccccacaccccctgctatctcttgatccccacttcagccacgatgggacgtccagc
ggcgactcctcttccggcggcctgaccagccaggagagcaccatggaacgccagaagcca
gagcctttgtggcatgtgcctgcccaggccaggctctcagccatagccggaagcagcggg
aacaagcacccgtccaggcaggatgcagcaggcaaagattcccccaacaggcattccaaa
ggagaacctcaatactcaagtcattccagcagcaacaccctctccagcaacgcatccagc
agccacagcgacgaccgctggttcgaccccctggaccccctggagccagagcaagacccc
ctctccaagggtggctctagtgacagcggcatcgacaccaccctctacacctccagccct
agctgcatgtccctggccaaggctccacggcccgccaagccacacaagccccctggaagt
atgggcctttgtggcgggggtcgcgaggccgctgggaggtcccaccacgcagacaggcgg
cgggaggtctcccctgcccccgcagttgccggccaaagcaagggctaccgaccgaagctg
tactcctccggctccagcacccccacgggactggcggggggcagccgagacccaccgagg
cagcccagtgacatgggctcgagggttggctaccccgctcaggtttacaaaactgccagt
gcagagactcctcggccctcccagctggcccagcccagcccctttcagctctccgcctcc
gtccccaagtccttcttctccaagcagcctgtacgcaataagcacccaacagggtggaag
agaacggaggagcccccaccacggccactccccttcagtgacccaaagaagcaggtggac
acgaacaccaaaaatgtctttgggcaaccgaggttgagggcatccctccgagacctccgg
tcaccacggaagaactacaaatccaccatcgaggatgacctgaagaaactcatcatcatg
gacaacctggggccagagcaggagagagacacgggacagtcaccgcagaagggcctgcag
cggacgctgtcggacgagagcctgtgcagcgggcgccgggagcccagcttcgccagcccc
gctggcctagagccagggctgcccagcgacgtgctcttcaccagcacctgcgccttcccg
tccagcacgctgcctgcacgccgccagcaccagcacccccacccgcccgtcggccccggt
gccacccctgccgccggcagcggctttcccgagaagaaatccaccatctcagcctcggag
ctctcgctggctgatgggcgggaccgccccctgcggcgcctggaccctgggctgatgccc
ctgcctgacacagctgctggcctcgagtggtccagcctggtgaacgcagccaaggcatac
gaagtgcaaagagccgtctcactcttctctctgaacgacccggccctgagcccggacatc
ccgcctgcacacagtcctgtccacagccacctgagcctggagaggggacccccgaccccc
aggaccacccctaccatgagcgaggagccacccctggatctgacaggcaaggtgtaccag
ctggaggtgatgctgaaacagctgcacactgacctgcagaaggagaagcaggacaaggtg
gtgctccagtcagaggtggccagcctgcggcagaacaaccagcggctgcaggaggagtcg
caggccgccagcgagcagctgcgcaagtttgcggagatcttctgcagggagaagaaggag
ctctga

DBGET integrated database retrieval system