KEGG   Homo sapiens (human): 23111Help
Entry
23111             CDS       T01001                                 

Gene name
SPART, SPG20, TAHCCP1
Definition
(RefSeq) spartin
  KO
K19366  spartin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    23111 (SPART)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Senescence MIT TPR_8
Motif
Other DBs
NCBI-GeneID: 23111
NCBI-ProteinID: NP_001135766
OMIM: 607111
HGNC: 18514
Ensembl: ENSG00000133104
Vega: OTTHUMG00000016730
Pharos: Q8N0X7(Tbio)
UniProt: Q8N0X7 A0A024RDV9
LinkDB All DBs
Structure
PDB: 

Position
13q13.3
AA seq 666 aa AA seqDB search
MEQEPQNGEPAEIKIIREAYKKAFLFVNKGLNTDELGQKEEAKNYYKQGIGHLLRGISIS
SKESEHTGPGWESARQMQQKMKETLQNVRTRLEILEKGLATSLQNDLQEVPKLYPEFPPK
DMCEKLPEPQSFSSAPQHAEVNGNTSTPSAGAVAAPASLSLPSQSCPAEAPPAYTPQAAE
GHYTVSYGTDSGEFSSVGEEFYRNHSQPPPLETLGLDADELILIPNGVQIFFVNPAGEVS
APSYPGYLRIVRFLDNSLDTVLNRPPGFLQVCDWLYPLVPDRSPVLKCTAGAYMFPDTML
QAAGCFVGVVLSSELPEDDRELFEDLLRQMSDLRLQANWNRAEEENEFQIPGRTRPSSDQ
LKEASGTDVKQLDQGNKDVRHKGKRGKRAKDTSSEEVNLSHIVPCEPVPEEKPKELPEWS
EKVAHNILSGASWVSWGLVKGAEITGKAIQKGASKLRERIQPEEKPVEVSPAVTKGLYIA
KQATGGAAKVSQFLVDGVCTVANCVGKELAPHVKKHGSKLVPESLKKDKDGKSPLDGAMV
VAASSVQGFSTVWQGLECAAKCIVNNVSAETVQTVRYKYGYNAGEATHHAVDSAVNVGVT
AYNINNIGIKAMVKKTATQTGHTLLEDYQIVDNSQRENQEGAANVNVRGEKDEQTKEVKE
AKKKDK
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggagcaagagccacaaaatggagaacctgctgaaattaagatcatcagagaagcatat
aagaaggcctttttatttgttaacaaaggtctgaatacagatgaattaggtcagaaggaa
gaagcaaagaactactataagcaaggaataggacacctgctcagagggatcagcatttca
tcaaaagagtctgaacacacaggtcctgggtgggaatctgctagacagatgcaacagaaa
atgaaagaaactctacagaatgtacgcaccaggctggaaattctagagaagggtcttgcc
acttctctgcagaatgatcttcaggaggtgcccaagttatatccagaatttccacctaaa
gacatgtgtgaaaaattaccagagcctcagtcttttagttcagctcctcagcatgctgaa
gtaaatggaaacacctcaactccaagtgcaggggcagttgctgcacctgcttctctgtct
ttaccatcacaaagttgtccagcagaagctcctcctgcttatactcctcaagctgctgaa
ggtcactacactgtatcctatggaacagattctggggagttttcatcagttggagaggag
ttttataggaatcattctcagccaccgcctcttgagaccttagggctggatgcagatgaa
ttgattttgataccaaatggagtacagattttttttgtaaatcctgcaggggaggttagt
gcaccttcgtatcctgggtaccttcgaattgtgaggtttttggataattctctcgatacg
gttctaaaccgtcctcccgggtttcttcaggtttgtgactggttatatcctctagttcct
gatagatctccggttctgaaatgtactgcgggagcctacatgtttcctgatacaatgcta
caagcagcaggatgctttgtgggggtcgtcctgtcctctgagttaccagaggatgataga
gagctctttgaggatctgttaaggcaaatgtctgaccttcggctccaggccaactggaac
agagcagaagaagaaaatgaattccaaatccctggaagaactagaccctcctctgaccaa
ctaaaagaagcctctggcactgatgtgaaacagttggaccaaggcaataaggatgtacgt
cataaaggaaaacgtggaaaaagggctaaagatacttcaagtgaagaagttaacctgagt
cacattgtaccatgtgagccagttccagaagaaaagccaaaagaattacctgaatggagt
gaaaaagtggctcacaacattttgtcaggtgcttcctgggtgagttggggtttagtcaaa
ggtgctgagattactggtaaggcaatccagaaaggtgcttctaaactccgagagcggatt
caaccagaagaaaaacccgtggaagttagtccagctgtcaccaagggactttatatagcg
aagcaagctacaggaggagcagcaaaagtcagtcagttcctggttgatggagtttgcact
gtagcaaattgcgttggaaaagaactagctccacatgtcaagaagcatggaagcaaactt
gttccagaatctcttaaaaaagacaaagatgggaaatctcctctggatggtgctatggtt
gtagcagcaagtagtgttcaaggattttcaactgtctggcaaggattggaatgtgcagct
aaatgcatcgttaacaatgtttcagcagaaactgtacaaactgtcagatacaaatacgga
tataatgcaggagaagctacccaccatgcggtggattctgcggtcaatgttggcgtaact
gcctacaatattaacaacattggtatcaaagcaatggtgaagaaaactgcaacacaaaca
ggacacactctccttgaggactatcagatagttgataattctcagagggaaaatcaagaa
ggagcagcaaatgtcaacgtgagaggggagaaggatgagcagacgaaggaagtaaaggag
gcaaagaagaaagataaatga

DBGET integrated database retrieval system