KEGG   Homo sapiens (human): 23126
Entry
23126             CDS       T01001                                 

Gene name
POGZ, MRD37, WHSUS, ZNF280E, ZNF635, ZNF635m
Definition
(RefSeq) pogo transposable element derived with ZNF domain
  KO
K22594  pogo transposable element with ZNF domain
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23126 (POGZ)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    23126 (POGZ)
SSDB
Motif
Pfam: DDE_1 HTH_Tnp_Tc5 zf-C2H2_4 HTH_28 DDE_3 HTH_23
Other DBs
NCBI-GeneID: 23126
NCBI-ProteinID: NP_055915
OMIM: 614787
HGNC: 18801
Ensembl: ENSG00000143442
Vega: OTTHUMG00000012499
Pharos: Q7Z3K3(Tbio)
UniProt: Q7Z3K3
LinkDB
Structure
PDB: 
2E72

Position
1q21.3
AA seq 1410 aa
MADTDLFMECEEEELEPWQKISDVIEDSVVEDYNSVDKTTTVSVSQQPVSAPVPIAAHAS
VAGHLSTSTTVSSSGAQNSDSTKKTLVTLIANNNAGNPLVQQGGQPLILTQNPAPGLGTM
VTQPVLRPVQVMQNANHVTSSPVASQPIFITTQGFPVRNVRPVQNAMNQVGIVLNVQQGQ
TVRPITLVPAPGTQFVKPTVGVPQVFSQMTPVRPGSTMPVRPTTNTFTTVIPATLTIRST
VPQSQSQQTKSTPSTSTTPTATQPTSLGQLAVQSPGQSNQTTNPKLAPSFPSPPAVSIAS
FVTVKRPGVTGENSNEVAKLVNTLNTIPSLGQSPGPVVVSNNSSAHGSQRTSGPESSMKV
TSSIPVFDLQDGGRKICPRCNAQFRVTEALRGHMCYCCPEMVEYQKKGKSLDSEPSVPSA
AKPPSPEKTAPVASTPSSTPIPALSPPTKVPEPNENVGDAVQTKLIMLVDDFYYGRDGGK
VAQLTNFPKVATSFRCPHCTKRLKNNIRFMNHMKHHVELDQQNGEVDGHTICQHCYRQFS
TPFQLQCHLENVHSPYESTTKCKICEWAFESEPLFLQHMKDTHKPGEMPYVCQVCQYRSS
LYSEVDVHFRMIHEDTRHLLCPYCLKVFKNGNAFQQHYMRHQKRNVYHCNKCRLQFLFAK
DKIEHKLQHHKTFRKPKQLEGLKPGTKVTIRASRGQPRTVPVSSNDTPPSALQEAAPLTS
SMDPLPVFLYPPVQRSIQKRAVRKMSVMGRQTCLECSFEIPDFPNHFPTYVHCSLCRYST
CCSRAYANHMINNHVPRKSPKYLALFKNSVSGIKLACTSCTFVTSVGDAMAKHLVFNPSH
RSSSILPRGLTWIAHSRHGQTRDRVHDRNVKNMYPPPSFPTNKAATVKSAGATPAEPEEL
LTPLAPALPSPASTATPPPTPTHPQALALPPLATEGAECLNVDDQDEGSPVTQEPELASG
GGGSGGVGKKEQLSVKKLRVVLFALCCNTEQAAEHFRNPQRRIRRWLRRFQASQGENLEG
KYLSFEAEEKLAEWVLTQREQQLPVNEETLFQKATKIGRSLEGGFKISYEWAVRFMLRHH
LTPHARRAVAHTLPKDVAENAGLFIDFVQRQIHNQDLPLSMIVAIDEISLFLDTEVLSSD
DRKENALQTVGTGEPWCDVVLAILADGTVLPTLVFYRGQMDQPANMPDSILLEAKESGYS
DDEIMELWSTRVWQKHTACQRSKGMLVMDCHRTHLSEEVLAMLSASSTLPAVVPAGCSSK
IQPLDVCIKRTVKNFLHKKWKEQAREMADTACDSDVLLQLVLVWLGEVLGVIGDCPELVQ
RSFLVASVLPGPDGNINSPTRNADMQEELIASLEEQLKLSGEHSESSTPRPRSSPEETIE
PESLHQLFEGESETESFYGFEEADLDLMEI
NT seq 4233 nt   +upstreamnt  +downstreamnt
atggcggacaccgacctgttcatggaatgtgaggaggaggagttggagccatggcagaaa
atcagtgatgtcattgaggactctgtagttgaagattataattcagtggataaaactacc
acagtttctgtgagccagcagccagtctcggctccagtgcccatcgctgcccatgcttct
gttgctgggcacctctctacatccaccaccgttagtagcagcggggcacagaacagcgac
agtacaaagaagactcttgtcacactaattgccaacaacaatgctggcaatcctttggtc
cagcaaggtggacagccactcatcctgacccagaatccagccccaggtctgggcacaatg
gttactcaaccagtattgaggcctgttcaggtcatgcagaatgccaatcatgtgactagt
tcccctgtggcctcacaaccaatatttatcactacgcagggatttcctgtaaggaatgtc
cggcctgtacaaaatgcaatgaatcaggttgggattgtgctgaacgtacagcaaggccaa
acggttagaccaattacactagttccagccccaggtacccagtttgttaagccgacagtt
ggagttccacaagtgttctcccagatgacccctgtgaggccaggctccacaatgcctgtg
aggcccaccaccaacaccttcaccaccgtcatcccggccactcttaccattcgaagcacc
gtcccacagtcccagtcccagcagaccaagtccactcccagcacttctaccactcccact
gccacacagccaacctcactggggcaactagctgttcagtctccaggccagtcaaaccag
accacgaatcccaagctagctccctccttcccctctccacctgcagtgagcattgccagc
tttgtcactgtgaagcgacctggtgttacaggcgaaaatagcaatgaagtggccaaattg
gtgaatacccttaacaccatcccttccctgggccagagtcctgggccagtggtggtgtcc
aacaacagctctgctcatggctctcaaagaaccagcggacctgagtcttcaatgaaagtg
acctcttccatcccagtatttgacctccaggatggtggacggaaaatatgtccacgatgt
aatgctcaatttcgtgttactgaagctttgagaggtcacatgtgttactgttgcccagaa
atggttgaataccagaagaaaggaaagtccctggattcagaacccagtgtcccatcagca
gcaaagcccccatcccctgagaaaacagctcctgttgcttccacaccctcttctacacct
attcctgctctgtcaccgcctaccaaagtaccagaaccaaatgagaacgtgggcgatgcc
gtccagaccaaactcattatgcttgtagatgacttctactatggacgggatggtggcaaa
gtagcccagctcacaaatttccctaaggtcgccacatctttccgatgcccacattgtacc
aaaaggctaaaaaacaatattcgattcatgaaccatatgaaacaccacgtagaactcgat
cagcagaacggtgaggtagatggtcacactatctgccagcactgttaccgccagttttcc
actcccttccagcttcagtgccacttggaaaatgttcatagtccctatgaatctactacc
aagtgcaagatctgtgaatgggcgtttgaaagtgagccactatttctccagcatatgaag
gatactcataagcctggagagatgccttatgtttgccaggtgtgtcaatatcgctcctca
ctctactctgaggtagatgtccattttcggatgatccatgaggatacccggcatctgctc
tgcccttattgcctgaaggtcttcaaaaatggcaatgcattccaacagcattacatgagg
caccagaagagaaatgtttatcactgcaacaaatgccggctgcagtttctctttgccaag
gacaaaattgaacacaagcttcaacaccataaaaccttccgtaaacccaagcagctggag
ggcttgaaaccaggcaccaaggtgacaatccgggcttcccgagggcagccacgaactgtt
cctgtatcctctaatgatacacctcccagcgccttgcaggaggcagcaccgctgacctcc
tcaatggaccctctgcctgtcttcctttatccccctgtccagcgcagcatccagaagaga
gctgttaggaaaatgagtgtcatgggccggcagacatgcctggagtgcagcttcgagatc
ccagacttccctaatcatttccctacttacgtacactgctctctgtgtcgctatagcacc
tgctgttctcgagcttatgccaaccacatgatcaacaatcatgttccacggaagagcccc
aagtatttggctttgtttaaaaattctgtgagtggaatcaagctggcctgcacttcatgt
acctttgttacctctgtgggcgatgctatggccaagcatttggtattcaacccctctcac
agatccagcagcatcctgccacggggactcacttggatagctcactcaaggcatggccag
actcgtgaccgagtgcatgaccggaacgtgaagaatatgtaccctcctccttccttcccc
actaacaaagctgccactgtgaaatctgcgggggccaccccagctgagcctgaagagcta
ctaactcccttagccccagcactcccatcaccagcctcaactgcaaccccaccaccaacc
cccactcacccgcaggctttagcccttccaccgctggctacagagggagccgaatgtctg
aatgttgatgatcaggatgaagggagcccagtcacccaagaacctgagctagcatcaggt
ggtggtggtagtggtggagttggcaaaaaggagcagctgtctgtgaagaagcttcgagta
gtactgtttgctctatgctgcaatacagaacaggcagctgaacacttccgaaatccccag
cgacgtattcgccgttggcttcgacgtttccaggcctcccagggggagaatctagagggc
aaatatctgagctttgaggcagaagagaaactggctgagtgggtgctaacccagcgcgaa
caacagctacctgtaaatgaggagaccttgttccagaaggccaccaaaataggacgttct
ttggaaggggggtttaagatctcctatgagtgggctgtgcgtttcatgctgcggcaccac
ctgactccccatgcccggcgagctgtggcccacaccctacctaaggatgtagcagagaat
gcaggactcttcattgattttgtacaacggcagattcacaaccaggacttacccttgtct
atgattgtggctattgatgagatctctttgttcctggatacagaggtgctgagcagtgat
gatcgaaaggagaatgccctgcagacagtgggcacaggggaaccttggtgtgatgtagtc
ctagccattctggcagatggcactgtccttcccaccctggttttctacagagggcagatg
gatcagcctgctaacatgccagactccatattgctagaggcaaaggagagtggctacagt
gatgacgagatcatggagctgtggtcaactcgagtgtggcagaagcacacagcttgccag
cgcagcaaaggcatgcttgtgatggactgtcatcgcactcacttgtcagaagaggtactg
gctatgcttagtgcctctagcactttgcctgcagtggtcccagcaggctgtagctccaaa
attcagccattagatgtatgcatcaaaagaactgtcaagaacttcctgcataaaaaatgg
aaggaacaggctcgggaaatggcagatactgcatgtgattctgatgtcctgcttcagctg
gtgcttgtctggctgggtgaagtgctaggtgtcattggggactgtccagagctagttcag
cgctccttcctggtggctagtgttctgcctggccccgatggcaacattaactcacctaca
agaaatgctgacatgcaggaggagctaattgcctccctagaggagcaactgaagctgagt
ggggaacattctgagtcttccactccacgacccagatcatctcctgaagagacaattgag
cctgaaagtcttcaccagctctttgagggtgaaagtgagaccgagtctttctatggcttt
gaagaagctgacctagatctgatggagatttga

DBGET integrated database retrieval system