KEGG   Homo sapiens (human): 2313Help
Entry
2313              CDS       T01001                                 

Gene name
FLI1, BDPLT21, EWSR2, SIC-1
Definition
(RefSeq) Fli-1 proto-oncogene, ETS transcription factor
  KO
K09436  friend leukemia integration 1 transcription factor
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
nt06240  Transcription
  Element
N00133  EWSR1-FLI1 fusion to transcriptional activation
N00134  EWSR1-FLI1 fusion to transcriptional repression
Disease
H00035  Ewing sarcoma
H01235  Bleeding disorder platelet-type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    2313 (FLI1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2313 (FLI1)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    2313 (FLI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT
Motif
Other DBs
NCBI-GeneID: 2313
NCBI-ProteinID: NP_002008
OMIM: 193067
HGNC: 3749
Ensembl: ENSG00000151702
Vega: OTTHUMG00000165792
Pharos: Q01543(Tbio)
UniProt: Q01543 A0A024R3M5
LinkDB All DBs
Structure
PDB: 

Position
11q24.3
AA seq 452 aa AA seqDB search
MDGTIKEALSVVSDDQSLFDSAYGAAAHLPKADMTASGSPDYGQPHKINPLPPQQEWINQ
PVRVNVKREYDHMNGSRESPVDCSVSKCSKLVGGGESNPMNYNSYMDEKNGPPPPNMTTN
ERRVIVPADPTLWTQEHVRQWLEWAIKEYSLMEIDTSFFQNMDGKELCKMNKEDFLRATT
LYNTEVLLSHLSYLRESSLLAYNTTSHTDQSSRLSVKEDPSYDSVRRGAWGNNMNSGLNK
SPPLGGAQTISKNTEQRPQPDPYQILGPTSSRLANPGSGQIQLWQFLLELLSDSANASCI
TWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKF
DFHGIAQALQPHPTESSMYKYPSDISYMPSYHAHQQKVNFVPPHPSSMPVTSSSFFGAAS
QYWTSPTGGIYPNPNVPRHPNTHVPSHLGSYY
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggacgggactattaaggaggctctgtcggtggtgagcgacgaccagtccctctttgac
tcagcgtacggagcggcagcccatctccccaaggccgacatgactgcctcggggagtcct
gactacgggcagccccacaagatcaaccccctcccaccacagcaggagtggatcaatcag
ccagtgagggtcaacgtcaagcgggagtatgaccacatgaatggatccagggagtctccg
gtggactgcagcgttagcaaatgcagcaagctggtgggcggaggcgagtccaaccccatg
aactacaacagctatatggacgagaagaatggcccccctcctcccaacatgaccaccaac
gagaggagagtcatcgtccccgcagaccccacactgtggacacaggagcatgtgaggcaa
tggctggagtgggccataaaggagtacagcttgatggagatcgacacatcctttttccag
aacatggatggcaaggaactgtgtaaaatgaacaaggaggacttcctccgcgccaccacc
ctctacaacacggaagtgctgttgtcacacctcagttacctcagggaaagttcactgctg
gcctataatacaacctcccacaccgaccaatcctcacgattgagtgtcaaagaagaccct
tcttatgactcagtcagaagaggagcttggggcaataacatgaattctggcctcaacaaa
agtcctccccttggaggggcacaaacgatcagtaagaatacagagcaacggccccagcca
gatccgtatcagatcctgggcccgaccagcagtcgcctagccaaccctggaagcgggcag
atccagctgtggcaattcctcctggagctgctctccgacagcgccaacgccagctgtatc
acctgggaggggaccaacggggagttcaaaatgacggaccccgatgaggtggccaggcgc
tggggcgagcggaaaagcaagcccaacatgaattacgacaagctgagccgggccctccgt
tattactatgataaaaacattatgaccaaagtgcacggcaaaagatatgcttacaaattt
gacttccacggcattgcccaggctctgcagccacatccgaccgagtcgtccatgtacaag
tacccttctgacatctcctacatgccttcctaccatgcccaccagcagaaggtgaacttt
gtccctccccatccatcctccatgcctgtcacttcctccagcttctttggagccgcatca
caatactggacctcccccacggggggaatctaccccaaccccaacgtcccccgccatcct
aacacccacgtgccttcacacttaggcagctactactag

DBGET integrated database retrieval system