KEGG   Homo sapiens (human): 23191
Entry
23191             CDS       T01001                                 

Gene name
CYFIP1, P140SRA-1, SHYC, SRA-1, SRA1
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 1
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    23191 (CYFIP1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    23191 (CYFIP1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23191 (CYFIP1)
   05132 Salmonella infection
    23191 (CYFIP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    23191 (CYFIP1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     23191 (CYFIP1)
   Factors involved in mRNA localization
    Other mRNA localization factors
     23191 (CYFIP1)
SSDB
Motif
Pfam: FragX_IP DUF1394 BP28CT
Other DBs
NCBI-GeneID: 23191
NCBI-ProteinID: NP_001274739
OMIM: 606322
HGNC: 13759
Ensembl: ENSG00000273749
Vega: OTTHUMG00000129100
Pharos: Q7L576(Tbio)
UniProt: Q7L576
LinkDB
Structure
PDB: 
3P8C 4N78

Position
15q11.2
AA seq 1253 aa
MAAQVTLEDALSNVDLLEELPLPDQQPCIEPPPSSLLYQPNFNTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGQEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMNFMYFQRNAIERFCGEVRRLCHAERRKDFVSEAYLITLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNKITQSLQQQLEVISGYEELLAD
IVNLCVDYYENRMYLTPSEKHMLLKVMGFGLYLMDGSVSNIYKLDAKKRINLSKIDKYFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSRWTCTSSGSSPQYNICEQMIQIREDHMRFI
SELARYSNSEVVTGSGRQEAQKTDAEYRKLFDLALQGLQLLSQWSAHVMEVYSWKLVHPT
DKYSNKDCPDSAEEYERATRYNYTSEEKFALVEVIAMIKGLQVLMGRMESVFNHAIRHTV
YAALQDFSQVTLREPLRQAIKKKKNVIQSVLQAIRKTVCDWETGHEPFNDPALRGEKDPK
SGFDIKVPRRAVGPSSTQLYMVRTMLESLIADKSGSKKTLRSSLEGPTILDIEKFHRESF
FYTHLINFSETLQQCCDLSQLWFREFFLELTMGRRIQFPIEMSMPWILTDHILETKEASM
MEYVLYSLDLYNDSAHYALTRFNKQFLYDEIEAEVNLCFDQFVYKLADQIFAYYKVMAGS
LLLDKRLRSECKNQGATIHLPPSNRYETLLKQRHVQLLGRSIDLNRLITQRVSAAMYKSL
ELAIGRFESEDLTSIVELDGLLEINRMTHKLLSRYLTLDGFDAMFREANHNVSAPYGRIT
LHVFWELNYDFLPNYCYNGSTNRFVRTVLPFSQEFQRDKQPNAQPQYLHGSKALNLAYSS
IYGSYRNFVGPPHFQVICRLLGYQGIAVVMEELLKVVKSLLQGTILQYVKTLMEVMPKIC
RLPRHEYGSPGILEFFHHQLKDIVEYAELKTVCFQNLREVGNAILFCLLIEQSLSLEEVC
DLLHAAPFQNILPRVHVKEGERLDAKMKRLESKYAPLHLVPLIERLGTPQQIAIAREGDL
LTKERLCCGLSMFEVILTRIRSFLDDPIWRGPLPSNGVMHVDECVEFHRLWSAMQFVYCI
PVGTHEFTVEQCFGDGLHWAGCMIIVLLGQQRRFAVLDFCYHLLKVQKHDGKDEIIKNVP
LKKMVERIRKFQILNDEIITILDKYLKSGDGEGTPVEHVRCFQPPIHQSLASS
NT seq 3762 nt   +upstreamnt  +downstreamnt
atggcggcccaggtgactctggaggacgcgctgtccaacgtggacctcctggaggagctg
cccctgcccgaccagcagccctgcatcgagcccccgccatcctcgctgctctaccagcca
aatttcaacactaactttgaagacagaaatgcatttgttactggcatcgcaagatacatt
gaacaagccaccgtccactctagcatgaacgagatgctggaggagggccaagaatatgct
gtcatgctgtacacctggaggagctgctcccgggccatcccacaggtgaaatgtaacgag
cagcctaacagagtggaaatctacgagaaaaccgtggaggttctggagcctgaggtcaca
aaactgatgaatttcatgtacttccagagaaatgccattgagcgtttctgcggggaagtg
aggcgcctgtgccatgccgagaggaggaaggacttcgtgtcagaagcctacctgatcaca
ctgggcaaattcatcaacatgttcgctgtgctggacgagctgaagaacatgaagtgcagt
gtgaagaacgaccactcagcgtacaagagggccgctcagtttttacgtaaaatggcagat
ccacagtccatccaggaatcgcagaatctgtccatgttcctggccaatcataacaagatc
acacagtctctgcagcagcagctcgaagtgatttctggctacgaagagctcctggcagat
attgtgaatctgtgtgtggattactacgagaacaggatgtatttgacgcccagtgagaaa
cacatgcttctcaaagtcatgggatttggtctgtacctgatggatgggagtgtcagtaac
atctataagttggatgccaagaaaagaataaacttatccaaaatcgacaagtacttcaag
caactccaggtggttccgctatttggggacatgcaaatagaactggcaagatatatcaag
accagcgcccactacgaggaaaataaatctcgatggacgtgcacatcctccggcagcagc
cctcagtacaacatctgcgagcagatgatccagatccgcgaggaccacatgcgcttcatt
tcggagctggcgcgctacagcaacagcgaggtggtcacgggctcgggccgccaggaggcc
cagaagacggacgcggagtaccgcaagctcttcgacctggcgctgcagggcctgcagctg
ttgtcgcagtggagcgcgcacgtgatggaagtgtattcctggaagcttgtgcaccccacc
gacaagtactccaacaaggactgccccgacagcgctgaagagtacgagcgtgccacgcgc
tacaactacaccagcgaggagaagtttgccctagtggaggtgatcgccatgatcaaaggc
ctgcaggtgctgatgggcaggatggagagcgtgttcaaccacgccatccggcacaccgtc
tatgccgcactgcaggacttctcccaggtgacccttagggagccgctgcggcaggccatc
aagaagaagaagaacgtcatccagagtgtcctgcaggccatcaggaagaccgtgtgtgac
tgggagacggggcatgagcccttcaatgacccagccttgcggggcgagaaggaccccaag
agcggcttcgacataaaagtaccacgccgcgccgtgggaccctccagcactcagctttac
atggtgagaaccatgctagagtccctcattgcagacaaaagtggttccaagaaaaccttg
agaagtagccttgaggggcccaccatattggacatagaaaaatttcatcgagagtcattc
ttctacactcacttgataaatttcagtgaaacgctgcagcagtgctgtgacctttcgcag
ctgtggttccgagagttcttcctggagctgaccatgggcaggaggatccagttccccatt
gagatgtcgatgccctggatcctgacggaccacatcctggagaccaaggaggcatcgatg
atggagtacgtgctctactccctggacctgtacaatgacagcgcccactacgcgctcacc
aggttcaacaagcagttcctgtacgacgaaattgaggccgaggtgaatctatgttttgac
caatttgtttacaagctagcagaccagatatttgcctattataaggttatggcaggaagt
ttgcttcttgataaacggttacgatcagaatgcaagaatcagggagccacgatccacctc
ccgccgtctaaccgctacgagacgctgctgaagcagaggcatgtgcagctcctcggcaga
tcaatagacctcaatcgtctgatcacccagcgcgtctcagcagccatgtataagtcccta
gaactggcgattggacgatttgaaagtgaagatttgacctccatagttgagctggatggc
ctgttggaaatcaaccgcatgacccacaagctgctgagccggtacctgacgctggacggc
ttcgacgccatgttccgggaggccaaccacaacgtgtcagcgccctacgggaggatcacc
ctgcacgtcttctgggagctcaactatgacttcctgcccaactactgctacaacggctct
accaaccggtttgttcggacagtgttaccattttctcaggaatttcaaagagataagcag
cctaatgcacagcctcagtatctgcatggatccaaggctttgaacttggcctactccagc
atttacggcagctaccggaacttcgtgggacctccacactttcaagtcatctgccggctt
ctcggctaccagggtatcgccgtggtcatggaggagctgctgaaggtcgtcaagagcctg
ctgcaaggcacaatcctgcagtacgtgaagacgctgatggaggtgatgcccaagatctgc
cgcctgccccggcacgagtacggctctcctggtatcctggagttcttccaccaccagctg
aaggacatcgtggagtacgcagagctgaagacggtgtgcttccagaacctgcgggaggtg
gggaacgccatcctcttctgcctgctcatcgagcagagcctgtctttagaagaagtgtgt
gacctgctgcacgcggctcctttccagaacatcttgccgcgagtccatgtgaaagagggg
gagagacttgatgccaaaatgaaaagactagaatcaaagtacgccccgctgcatcttgtc
ccactgattgaaagactggggacccctcagcaaattgccatcgcaagagagggggacctg
ctgacaaaggagcgcctctgctgcggcctgtccatgtttgaggtcatcctgacacggatc
cggagctttctggatgaccccatctggcgcgggcctctgcccagcaatggggtcatgcat
gtggacgagtgtgtggagtttcacagactgtggagtgccatgcagtttgtctactgcatt
cccgtggggacacacgagttcacagtcgagcagtgctttggtgatgggctacactgggct
ggctgtatgatcatcgtacttcttgggcagcagcggcgttttgctgtgctggatttctgc
taccatctacttaaagtccagaaacatgatggcaaagatgagattattaaaaatgtgcct
ttgaagaagatggtggagagaattcgcaagttccagattctcaatgatgagatcatcacc
atcctggataagtacctgaagtcaggcgacggggagggcacgccagtggagcatgtgcgc
tgcttccagccgcccatccaccagtccctcgccagcagctga

KEGG   Homo sapiens (human): 26999
Entry
26999             CDS       T01001                                 

Gene name
CYFIP2, EIEE65, PIR121
Definition
(RefSeq) cytoplasmic FMR1 interacting protein 2
  KO
K05749  cytoplasmic FMR1 interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04810  Regulation of actin cytoskeleton
hsa05130  Pathogenic Escherichia coli infection
hsa05132  Salmonella infection
Network
nt06135  Cytoskeletal regulation (viruses and bacteria)
  Element
N01066  ARNO-ARF-ACTB_G signaling pathway
N01067  Shigella IpgD to ARNO-ARF-ACTB_G signaling pathway
N01128  Salmonella SopE to RAC signaling pathway
N01129  Salmonella SopB to ARNO-ARF-ACTB/G signaling pathway
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    26999 (CYFIP2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    26999 (CYFIP2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    26999 (CYFIP2)
   05132 Salmonella infection
    26999 (CYFIP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    26999 (CYFIP2)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     26999 (CYFIP2)
   Factors involved in mRNA localization
    Other mRNA localization factors
     26999 (CYFIP2)
SSDB
Motif
Pfam: FragX_IP DUF1394 zf-CW
Other DBs
NCBI-GeneID: 26999
NCBI-ProteinID: NP_001278651
OMIM: 606323
HGNC: 13760
Ensembl: ENSG00000055163
Vega: OTTHUMG00000163484
Pharos: Q96F07(Tbio)
UniProt: Q96F07
LinkDB
Position
5q33.3
AA seq 1278 aa
MTTHVTLEDALSNVDLLEELPLPDQQPCIEPPPSSIMYQANFDTNFEDRNAFVTGIARYI
EQATVHSSMNEMLEEGHEYAVMLYTWRSCSRAIPQVKCNEQPNRVEIYEKTVEVLEPEVT
KLMKFMYFQRKAIERFCSEVKRLCHAERRKDFVSEAYLLTLGKFINMFAVLDELKNMKCS
VKNDHSAYKRAAQFLRKMADPQSIQESQNLSMFLANHNRITQCLHQQLEVIPGYEELLAD
IVNICVDYYENKMYLTPSEKHMLLKVMGFGLYLMDGNVSNIYKLDAKKRINLSKIDKFFK
QLQVVPLFGDMQIELARYIKTSAHYEENKSKWTCTQSSISPQYNICEQMVQIRDDHIRFI
SELARYSNSEVVTGSGLDSQKSDEEYRELFDLALRGLQLLSKWSAHVMEVYSWKLVHPTD
KFCNKDCPGTAEEYERATRYNYTSEEKFAFVEVIAMIKGLQVLMGRMESVFNQAIRNTIY
AALQDFAQVTLREPLRQAVRKKKNVLISVLQAIRKTICDWEGGREPPNDPCLRGEKDPKG
GFDIKVPRRAVGPSSTQACQWSPRALFHPTGGTQGRRGCRSLLYMVRTMLESLIADKSGS
KKTLRSSLDGPIVLAIEDFHKQSFFFTHLLNISEALQQCCDLSQLWFREFFLELTMGRRI
QFPIEMSMPWILTDHILETKEPSMMEYVLYPLDLYNDSAYYALTKFKKQFLYDEIEAEVN
LCFDQFVYKLADQIFAYYKAMAGSVLLDKRFRAECKNYGVIIPYPPSNRYETLLKQRHVQ
LLGRSIDLNRLITQRISAAMYKSLDQAISRFESEDLTSIVELEWLLEINRLTHRLLCKHM
TLDSFDAMFREANHNVSAPYGRITLHVFWELNFDFLPNYCYNGSTNRFVRTAIPFTQEPQ
RDKPANVQPYYLYGSKPLNIAYSHIYSSYRNFVGPPHFKTICRLLGYQGIAVVMEELLKI
VKSLLQGTILQYVKTLIEVMPKICRLPRHEYGSPGILEFFHHQLKDIIEYAELKTDVFQS
LREVGNAILFCLLIEQALSQEEVCDLLHAAPFQNILPRVYIKEGERLEVRMKRLEAKYAP
LHLVPLIERLGTPQQIAIAREGDLLTKERLCCGLSMFEVILTRIRSYLQDPIWRGPPPTN
GVMHVDECVEFHRLWSAMQFVYCIPVGTNEFTAEQCFGDGLNWAGCSIIVLLGQQRRFDL
FDFCYHLLKVQRQDGKDEIIKNVPLKKMADRIRKYQILNNEVFAILNKYMKSVETDSSTV
EHVRCFQPPIHQSLATTC
NT seq 3837 nt   +upstreamnt  +downstreamnt
atgaccacgcacgtcaccctggaagatgccctgtccaacgtggacctgcttgaagagctt
cccctccccgaccagcagccatgcatcgagcctccaccttcctccatcatgtaccaggct
aactttgacacaaactttgaggacaggaatgcatttgtcacgggcattgcaaggtacatt
gagcaggctacagtccactccagcatgaatgagatgctggaggaaggacatgagtatgcg
gtcatgctgtacacctggcgcagctgttcccgggccattccccaggtgaaatgcaacgag
cagcccaaccgagtagagatctatgagaagacagtagaggtgctggagccggaggtcacc
aagctcatgaagttcatgtattttcagcgcaaggccatcgagcggttctgcagcgaggtg
aagcggctgtgccatgccgagcgcaggaaggactttgtctctgaggcctacctcctgacc
cttggcaagttcatcaacatgtttgctgtcctggatgagctaaagaacatgaagtgcagc
gtcaagaatgaccactctgcctacaagagggcagcacagttcctgcggaagatggcagat
ccccagtctatccaggagtcgcagaacctttccatgttcctggccaaccacaacaggatc
acccagtgtctccaccagcaacttgaagtgatcccaggctatgaggagctgctggctgac
attgtcaacatctgtgtggattactacgagaacaagatgtacctgactcccagtgagaaa
catatgctcctcaaggtgatgggctttggcctctacctaatggatggaaatgtcagtaac
atttacaaactggatgccaagaagagaattaatcttagcaaaattgataaattctttaag
cagctgcaggtggtgccccttttcggcgacatgcagatagagctggccagatacattaag
accagtgctcactatgaagagaacaagtccaagtggacgtgcacccagagcagcatcagc
ccccagtacaatatctgcgagcagatggttcagatccgggatgaccacatccgcttcatc
tccgagctcgctcgctacagcaacagtgaggtggtgacgggctcagggctggacagccag
aagtcagacgaggagtatcgcgagctcttcgacctagccctgcggggtctgcagcttcta
tccaagtggagcgcccacgtcatggaggtgtactcttggaagctggttcatcccacagac
aagttctgcaacaaggactgtcctggcaccgcggaggaatatgagagagccacacgctac
aattacaccagtgaggaaaaatttgccttcgttgaggtgatcgccatgatcaaaggcctg
caggtgctcatgggcaggatggagagcgtcttcaaccaggccatcaggaacaccatctac
gcggcattgcaggacttcgcccaggtgacgctgcgtgagcccctgcggcaggcggtacgg
aagaagaagaatgtcctcatcagcgtcctacaggcaattcgaaagaccatctgtgactgg
gagggagggcgagagccccctaatgacccatgcttgagaggggagaaggaccccaaaggt
ggatttgatatcaaggtgccccggcgtgctgtggggccatccagcacacaggcctgccag
tggtccccgagggctttgtttcaccccactggtggcacacagggccgaagaggctgccga
tccctgctgtacatggtgcggaccatgcttgaatcactcattgcagacaaaagcggctcc
aagaagaccctgaggagcagcctggatggacccattgtcctcgccatagaggactttcac
aaacagtccttcttcttcacacatctgctcaacatcagtgaagccctgcagcagtgttgt
gacctctcccagctctggttccgagaattcttcctggagttaaccatgggccgacgaatc
cagttccccatcgagatgtccatgccctggattctaacggaccatatcctggaaaccaaa
gaaccttccatgatggagtatgtcctctaccctctggatctgtacaacgacagcgcctac
tatgctctgaccaagtttaaaaagcagttcctgtacgatgagatagaagctgaggtgaac
ctgtgttttgatcagtttgtctacaagctggcagaccagatctttgcttactacaaagcc
atggctggcagtgtcctgttggataaacgttttcgagctgagtgtaagaattatggcgtc
atcattccgtatccaccgtccaatcgctatgaaacactgctgaagcagagacacgtccag
ctgttgggtagatcaattgacttgaacagactcattacccagcgcatctctgccgccatg
tataaatccttggaccaagctatcagccgctttgagagtgaggacctgacctccattgtg
gagctggagtggctgctggagattaaccggctcacgcatcggctgctctgtaagcatatg
acgctggacagcttcgatgccatgttccgagaggccaatcacaatgtgtccgccccctat
ggccgtatcaccctgcatgtcttctgggaactgaactttgactttctccccaactactgc
tacaatgggtccactaaccgttttgtgcggactgccattcctttcacccaagaaccacaa
cgagacaaacctgccaacgtccagccttattacctctatggatccaagcctctcaacatt
gcctacagccacatctacagctcctacaggaatttcgtggggccacctcatttcaagact
atctgcagactcctgggttatcagggcatcgctgtggtcatggaggaactgctaaagatt
gtgaagagcttgctccaaggaaccattctccagtatgtgaaaacactgatagaggtgatg
cccaagatatgccgcttgccccgacatgagtatggctccccagggatcctggagttcttc
caccaccagctgaaggacatcattgagtacgcagagctcaaaacagacgtgttccagagc
ctgagggaagtgggcaatgccatcctcttctgcctcctcatagagcaagctctgtctcag
gaggaggtctgcgatttgctccatgccgcacccttccaaaacatcttgcctagagtctac
atcaaagagggggagcgcctggaggtccggatgaaacgtctggaagccaagtatgccccg
ctccacctggtccctctgatcgagcggctggggacccctcagcaaatcgccattgctcgc
gagggtgacctcctgaccaaggagcggctgtgctgtggcctgtccatgttcgaggtcatc
ctgacccgcattcggagctacctgcaggaccccatctggcggggcccaccgcccaccaat
ggcgtcatgcacgtcgatgagtgtgtggagttccaccggctgtggagcgccatgcagttc
gtgtactgcatccctgtgggaaccaacgagttcacagctgagcagtgtttcggcgatggc
ttgaactgggctggttgctccatcattgtcctgctgggccagcagcgtcgctttgacctg
ttcgacttctgttaccacctgctaaaagtgcagaggcaggacgggaaggatgaaatcatt
aagaatgtgcccctgaagaagatggccgaccggatcaggaagtatcagatcttgaacaat
gaggtttttgccatcctgaacaaatacatgaagtccgtggagacagacagttccactgtg
gagcatgtgcgctgcttccagccacccatccaccagtccttggccaccacttgctaa

DBGET integrated database retrieval system