KEGG   Homo sapiens (human): 23216
Entry
23216             CDS       T01001                                 

Gene name
TBC1D1, TBC, TBC1
Definition
(RefSeq) TBC1 domain family member 1
  KO
K18341  TBC1 domain family member 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    23216 (TBC1D1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23216 (TBC1D1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    23216 (TBC1D1)
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    23216 (TBC1D1)
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab associated proteins
    23216 (TBC1D1)
SSDB
Motif
Pfam: RabGAP-TBC DUF3350 PID ER
Other DBs
NCBI-GeneID: 23216
NCBI-ProteinID: NP_055988
OMIM: 609850
HGNC: 11578
Ensembl: ENSG00000065882
Vega: OTTHUMG00000150302
Pharos: Q86TI0(Tbio)
UniProt: Q86TI0 Q8NC59 Q6PJJ8 B9A6J6
LinkDB
Structure
PDB: 
3QYE

Position
4p14
AA seq 1168 aa
MEPITFTARKHLLSNEVSVDFGLQLVGSLPVHSLTTMPMLPWVVAEVRRLSRQSTRKEPV
TKQVRLCVSPSGLRCEPEPGRSQQWDPLIYSSIFECKPQRVHKLIHNSHDPSYFACLIKE
DAVHRQSICYVFKADDQTKVPEIISSIRQAGKIARQEELHCPSEFDDTFSKKFEVLFCGR
VTVAHKKAPPALIDECIEKFNHVSGSRGSESPRPNPPHAAPTGSQEPVRRPMRKSFSQPG
LRSLAFRKELQDGGLRSSGFFSSFEESDIENHLISGHNIVQPTDIEENRTMLFTIGQSEV
YLISPDTKKIALEKNFKEISFCSQGIRHVDHFGFICRESSGGGGFHFVCYVFQCTNEALV
DEIMMTLKQAFTVAAVQQTAKAPAQLCEGCPLQSLHKLCERIEGMNSSKTKLELQKHLTT
LTNQEQATIFEEVQKLRPRNEQRENELIISFLRCLYEEKQKEHIHIGEMKQTSQMAAENI
GSELPPSATRFRLDMLKNKAKRSLTESLESILSRGNKARGLQEHSISVDLDSSLSSTLSN
TSKEPSVCEKEALPISESSFKLLGSSEDLSSDSESHLPEEPAPLSPQQAFRRRANTLSHF
PIECQEPPQPARGSPGVSQRKLMRYHSVSTETPHERKDFESKANHLGDSGGTPVKTRRHS
WRQQIFLRVATPQKACDSSSRYEDYSELGELPPRSPLEPVCEDGPFGPPPEEKKRTSREL
RELWQKAILQQILLLRMEKENQKLQASENDLLNKRLKLDYEEITPCLKEVTTVWEKMLST
PGRSKIKFDMEKMHSAVGQGVPRHHRGEIWKFLAEQFHLKHQFPSKQQPKDVPYKELLKQ
LTSQQHAILIDLGRTFPTHPYFSAQLGAGQLSLYNILKAYSLLDQEVGYCQGLSFVAGIL
LLHMSEEEAFKMLKFLMFDMGLRKQYRPDMIILQIQMYQLSRLLHDYHRDLYNHLEEHEI
GPSLYAAPWFLTMFASQFPLGFVARVFDMIFLQGTEVIFKVALSLLGSHKPLILQHENLE
TIVDFIKSTLPNLGLVQMEKTINQVFEMDIAKQLQAYEVEYHVLQEELIDSSPLSDNQRM
DKLEKTNSSLRKQNLDLLEQLQVANGRIQSLEATIEKLLSSESKLKQAMLTLELERSALL
QTVEELRRRSAEPSDREPECTQPEPTGD
NT seq 3507 nt   +upstreamnt  +downstreamnt
atggaaccaataacattcacagcaaggaaacatctgctttctaacgaggtctcggtggat
tttggcctgcagctggtgggctccctgcctgtgcattccctgaccaccatgcccatgctg
ccctgggttgtggctgaggtgcgaagactcagcaggcagtccaccagaaaggaacctgta
accaagcaagtccggctttgcgtttcaccctctggactgagatgtgaacctgagccaggg
agaagtcaacagtgggatcccctgatctattccagcatctttgagtgcaagcctcagcgt
gttcacaaactgattcacaacagtcatgacccaagttactttgcttgtctgattaaggaa
gacgctgtccaccggcagagtatctgctatgtgttcaaagccgatgatcaaacaaaagtg
cctgagatcatcagctccatccgtcaggcggggaagatcgcccggcaggaggagctgcac
tgcccgtccgagttcgacgacacgttttccaagaagttcgaggtgctcttctgcggccgc
gtgacggtggcgcacaagaaggctccgccggccctgatcgacgagtgcatcgagaagttc
aatcacgtcagcggcagccgggggtccgagagcccccgccccaacccgccccatgccgcg
cccacagggagccaggagcctgtgcgcaggcccatgcgcaagtccttctcccagcccggc
ctgcgctcgctggcctttaggaaggagctgcaggatgggggcctccgaagcagcggcttc
ttcagctccttcgaggagagcgacattgagaaccacctcattagcggacacaatattgtg
cagcccacagatatcgaggaaaatcgaactatgctcttcacgattggccagtctgaagtt
tacctcatcagtcctgacaccaaaaaaatagcattggagaaaaattttaaggagatatcc
ttttgctctcagggcatcagacacgtggaccactttgggtttatctgtcgggagtcttcc
ggaggtggcggctttcattttgtctgttacgtgtttcagtgcacaaatgaggctctggtt
gatgaaattatgatgaccctgaaacaggccttcacggtggccgcagtgcagcagacagct
aaggcgccagcccagctgtgtgagggctgccccctgcaaagcctgcacaagctctgtgag
aggatagagggaatgaattcttccaaaacaaaactagaactgcaaaagcacctgacgaca
ttaaccaatcaggagcaggcgactatttttgaagaggttcagaaattgagaccgagaaat
gagcagcgagagaatgaattgattatttcttttctgagatgtttatatgaagagaaacag
aaagaacacatccatattggggagatgaagcagacatcgcagatggcagcagagaatatt
ggaagtgaattaccacccagtgccactcgatttaggctagatatgctgaaaaacaaagca
aagagatctttaacagagtctttagaaagtattttgtcccggggtaataaagccagaggc
ctgcaggaacactccatcagtgtggatctggatagctccctgtctagtacattaagtaac
accagcaaagagccatctgtgtgtgaaaaggaggccttgcccatctctgagagctccttt
aagctcctcggctcctcggaggacctgtccagtgactcggagagtcatctcccagaagag
ccagctccgctgtcgccccagcaggccttcaggaggcgagcaaacaccctgagtcacttc
cccatcgaatgccaggaacctccacaacctgcccgggggtccccgggggtttcgcaaagg
aaacttatgaggtatcactcagtgagcacagagacgcctcatgaacgaaaggactttgaa
tccaaagcaaaccatcttggtgattctggtgggactcctgtgaagacccggaggcattcc
tggaggcagcagatattcctccgagtagccaccccgcagaaggcgtgcgattcttccagc
agatatgaagattattcagagctgggagagcttcccccacgatctcctttagaaccagtt
tgtgaagatgggccctttggccccccaccagaggaaaagaaaaggacatctcgtgagctc
cgagagctgtggcaaaaggctattcttcaacagatactgctgcttagaatggagaaggaa
aatcagaagctccaagcctctgaaaatgatttgctgaacaagcgcctgaagctcgattat
gaagaaattactccctgtcttaaagaagtaactacagtgtgggaaaagatgcttagcact
ccaggaagatcaaaaattaagtttgacatggaaaaaatgcactcggctgttgggcaaggt
gtgccacgtcatcaccgaggtgaaatctggaaatttctagctgagcaattccaccttaaa
caccagtttcccagcaaacagcagccaaaggatgtgccatacaaagaactcttaaagcag
ctgacttcccagcagcatgcgattcttattgaccttgggcgaacctttcctacacaccca
tacttctctgcccagcttggagcaggacagctatcgctttacaacattttgaaggcctac
tcacttctagaccaggaagtgggatattgccaaggtctcagctttgtagcaggcattttg
cttcttcatatgagtgaggaagaggcgtttaaaatgctcaagtttctgatgtttgacatg
gggctgcggaaacagtatcggccagacatgattattttacagatccagatgtaccagctc
tcgaggttgcttcatgattaccacagagacctctacaatcacctggaggagcacgagatc
ggccccagcctctacgctgccccctggttcctcaccatgtttgcctcacagttcccgctg
ggattcgtagccagagtctttgatatgatttttcttcagggaacagaggtcatatttaaa
gtggctttaagtctgttgggaagccataagcccttgattctgcagcatgaaaacctagaa
accatagttgactttataaaaagcacgctacccaaccttggcttggtacagatggaaaag
accatcaatcaggtatttgaaatggacatcgctaaacagttacaagcttatgaagttgag
taccacgtccttcaagaagaacttatcgattcctctcctctcagtgacaaccaaagaatg
gataaattagagaaaaccaacagcagcttacgcaaacagaaccttgacctccttgaacag
ttgcaggtggcaaatggtaggatccaaagccttgaggccaccattgagaagctcctgagc
agtgagagcaagctgaagcaggccatgcttaccttagaactggagcggtcggccctgctg
cagacggtggaggagctgcggcggcggagcgcagagcccagcgaccgggagcctgagtgc
acgcagcccgagcccacgggcgactga

DBGET integrated database retrieval system