KEGG   Homo sapiens (human): 2323Help
Entry
2323              CDS       T01001                                 

Gene name
FLT3LG, FL, FLG3L, FLT3L
Definition
(RefSeq) fms related tyrosine kinase 3 ligand
  KO
K05454  fms-related tyrosine kinase 3 ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04640  Hematopoietic cell lineage
hsa05200  Pathways in cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06262  Pancreatic cancer
nt06275  Acute myeloid leukemia
  Element
N00217  FLT3LG-FLT3-RAS-ERK signaling pathway
N00218  FLT3LG-FLT3-RAS-PI3K signaling pathway
N00219  FLT3LG-FLT3-STAT5 signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    2323 (FLT3LG)
   04010 MAPK signaling pathway
    2323 (FLT3LG)
   04151 PI3K-Akt signaling pathway
    2323 (FLT3LG)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    2323 (FLT3LG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    2323 (FLT3LG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    2323 (FLT3LG)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   2323 (FLT3LG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Flt3_lig
Motif
Other DBs
NCBI-GeneID: 2323
NCBI-ProteinID: NP_001191431
OMIM: 600007
HGNC: 3766
Ensembl: ENSG00000090554
Vega: OTTHUMG00000186490
Pharos: P49771(Tbio)
UniProt: P49771 B7ZLY4
LinkDB All DBs
Structure
PDB: 

Position
19q13.33
AA seq 235 aa AA seqDB search
MTVLAPAWSPTTYLLLLLLLSSGLSGTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTV
ASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQGLLERVNTEIHFVTKCAFQPPPSCL
RFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWSPRPLEATAPT
APQPPLLLLLLLPVGLLLLAAAWCLHWQRTRRRTPRPGEQVPPVPSPQDLLLVEH
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgacagtgctggcgccagcctggagcccaacaacctatctcctcctgctgctgctgctg
agctcgggactcagtgggacccaggactgctccttccaacacagccccatctcctccgac
ttcgctgtcaaaatccgtgagctgtctgactacctgcttcaagattacccagtcaccgtg
gcctccaacctgcaggacgaggagctctgcgggggcctctggcggctggtcctggcacag
cgctggatggagcggctcaagactgtcgctgggtccaagatgcaaggcttgctggagcgc
gtgaacacggagatacactttgtcaccaaatgtgcctttcagcccccccccagctgtctt
cgcttcgtccagaccaacatctcccgcctcctgcaggagacctccgagcagctggtggcg
ctgaagccctggatcactcgccagaacttctcccggtgcctggagctgcagtgtcagccc
gactcctcaaccctgccacccccatggagtccccggcccctggaggccacagccccgaca
gccccgcagccccctctgctcctcctactgctgctgcccgtgggcctcctgctgctggcc
gctgcctggtgcctgcactggcagaggacgcggcggaggacaccccgccctggggagcag
gtgccccccgtccccagtccccaggacctgctgcttgtggagcactga

DBGET integrated database retrieval system