KEGG   Homo sapiens (human): 23235
Entry
23235             CDS       T01001                                 

Gene name
SIK2, LOH11CR1I, QIK, SIK-2, SNF1LK2
Definition
(RefSeq) salt inducible kinase 2
  KO
K16311  serine/threonine-protein kinase SIK2 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04922  Glucagon signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    23235 (SIK2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23235 (SIK2)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23235 (SIK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     23235 (SIK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   23235 (SIK2)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    23235 (SIK2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Kdo DUF5716_C
Other DBs
NCBI-GeneID: 23235
NCBI-ProteinID: NP_056006
OMIM: 608973
HGNC: 21680
Ensembl: ENSG00000170145
Vega: OTTHUMG00000150644
Pharos: Q9H0K1(Tchem)
UniProt: Q9H0K1 A0A024R3G7
LinkDB
Position
11q23.1
AA seq 926 aa
MVMADGPRHLQRGPVRVGFYDIEGTLGKGNFAVVKLGRHRITKTEVAIKIIDKSQLDAVN
LEKIYREVQIMKMLDHPHIIKLYQVMETKSMLYLVTEYAKNGEIFDYLANHGRLNESEAR
RKFWQILSAVDYCHGRKIVHRDLKAENLLLDNNMNIKIADFGFGNFFKSGELLATWCGSP
PYAAPEVFEGQQYEGPQLDIWSMGVVLYVLVCGALPFDGPTLPILRQRVLEGRFRIPYFM
SEDCEHLIRRMLVLDPSKRLTIAQIKEHKWMLIEVPVQRPVLYPQEQENEPSIGEFNEQV
LRLMHSLGIDQQKTIESLQNKSYNHFAAIYFLLVERLKSHRSSFPVEQRLDGRQRRPSTI
AEQTVAKAQTVGLPVTMHSPNMRLLRSALLPQASNVEAFSFPASGCQAEAAFMEEECVDT
PKVNGCLLDPVPPVLVRKGCQSLPSNMMETSIDEGLETEGEAEEDPAHAFEAFQSTRSGQ
RRHTLSEVTNQLVVMPGAGKIFSMNDSPSLDSVDSEYDMGSVQRDLNFLEDNPSLKDIML
ANQPSPRMTSPFISLRPTNPAMQALSSQKREVHNRSPVSFREGRRASDTSLTQGIVAFRQ
HLQNLARTKGILELNKVQLLYEQIGPEADPNLAPAAPQLQDLASSCPQEEVSQQQESVST
LPASVHPQLSPRQSLETQYLQHRLQKPSLLSKAQNTCQLYCKEPPRSLEQQLQEHRLQQK
RLFLQKQSQLQAYFNQMQIAESSYPQPSQQLPLPRQETPPPSQQAPPFSLTQPLSPVLEP
SSEQMQYSPFLSQYQEMQLQPLPSTSGPRAAPPLPTQLQQQQPPPPPPPPPPRQPGAAPA
PLQFSYQTCELPSAASPAPDYPTPCQYPVDGAQQSDLTGPDCPRSPGLQEAPSSYDPLAL
SELPGLFDCEMLDAVDPQHNGYVLVN
NT seq 2781 nt   +upstreamnt  +downstreamnt
atggtcatggcggatggcccgaggcacttgcagcgcgggccggtccgggtggggttctac
gacatcgagggcacgctgggcaagggcaacttcgctgtggtgaagctggggcggcaccgg
atcaccaagacggaggtggcaataaaaataatcgataagtctcagctggatgcagtgaac
cttgagaaaatctaccgagaagtacaaataatgaaaatgttagaccaccctcacataatc
aaactttatcaggtaatggagaccaaaagtatgttgtaccttgtgacagaatatgccaaa
aatggagaaatttttgactatcttgctaatcatggccggttaaatgagtctgaagccagg
cgaaaattctggcaaatcctgtctgctgttgattattgtcatggtcggaagattgtgcac
cgtgacctcaaagctgaaaatctcctgctggataacaacatgaatatcaaaatagcagat
ttcggttttggaaatttctttaaaagtggtgaactgctggcaacatggtgtggcagcccc
ccttatgcagccccagaagtctttgaagggcagcagtatgaaggaccacagctggacatc
tggagtatgggagttgttctttatgtccttgtctgtggagctctgccctttgatggaccg
actcttccaattttgaggcagagggttctggaaggaagattccggattccgtatttcatg
tcagaagattgcgagcaccttatccgaaggatgttggtcctagacccatccaaacggcta
accatagcccaaatcaaggagcataaatggatgctcatagaagttcctgtccagagacct
gttctctatccacaagagcaagaaaatgagccatccatcggggagtttaatgagcaggtt
ctgcgactgatgcacagccttggaatagatcagcagaaaaccattgagtctttgcagaac
aagagctataaccactttgctgccatttatttcttgttggtggagcgcctgaaatcacat
cggagcagtttcccagtggagcagagacttgatggccgccagcgtcggcctagcaccatt
gctgagcaaacagttgccaaggcacagactgtggggctcccagtgaccatgcattcaccg
aacatgaggctgctgcgatctgccctcctcccccaggcatccaacgtggaggccttttca
tttccagcatctggctgtcaggcggaagctgcattcatggaagaagagtgtgtggacact
ccaaaggtcaatggctgtctgcttgaccctgtgcctcctgtcctggtgcggaagggatgc
cagtcactgcccagcaacatgatggagacctccattgacgaagggctggagacagaagga
gaggccgaggaagaccccgctcatgcctttgaggcatttcagtccacacgcagcgggcag
agacggcacactctgtcagaagtgaccaatcaactggtcgtgatgcctggggcagggaaa
attttctccatgaatgacagcccctcccttgacagtgtggactctgagtatgatatgggg
tctgttcagagggacctgaactttctggaagacaacccttcccttaaggacatcatgtta
gccaatcagccttcaccccgcatgacatctcccttcataagcctgagacctaccaaccca
gccatgcaggctctgagctcccagaaacgagaggtccacaacaggtctccagtgagcttc
agagagggccgcagagcatcagatacctccctcacccagggaattgtagcatttagacaa
catcttcagaatctggctagaaccaaaggaattctagagttgaacaaagtgcagttgttg
tatgaacaaataggaccggaggcagaccctaacctggcgccggcggctcctcagctccag
gaccttgctagcagctgccctcaggaagaagtttctcagcagcaggaaagcgtctccact
ctccctgccagcgtgcatccccagctgtccccacggcagagcctggagacccagtacctg
cagcacagactccagaagcccagccttctgtcaaaggcccagaacacctgtcagctttat
tgcaaagaaccaccgcggagccttgagcagcagctgcaggaacataggctccagcagaag
cgactctttcttcagaagcagtctcaactgcaggcctattttaatcagatgcagatagca
gagagctcctacccacagccaagtcagcagctgccccttccccgccaggagactccaccg
ccttctcagcaggccccaccgttcagcctgacccagcccctgagccccgtcctggagcct
tcctccgagcagatgcaatacagccctttcctcagccagtaccaagagatgcagcttcag
cccctgccctccacttccggtccccgggctgctcctcctctgcccacgcagctacagcag
cagcagccgccaccgccaccaccccctccaccaccacgacagccaggagctgccccagcc
cccttacagttctcctatcagacttgtgagctgccaagcgctgcttcccctgcgccagac
tatcccactccctgtcagtatcctgtggatggagcccagcagagcgacctaacggggcca
gactgtcccagaagcccaggactgcaagaggccccctccagctacgacccactagccctc
tctgagctacctggactctttgattgtgaaatgctagacgctgtggatccacaacacaac
gggtatgtcctggtgaattag

DBGET integrated database retrieval system