KEGG   Homo sapiens (human): 2326
Entry
2326              CDS       T01001                                 

Gene name
FMO1
Definition
(RefSeq) flavin containing dimethylaniline monoxygenase 1
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00982  Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    2326 (FMO1)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     2326 (FMO1)
SSDB
Motif
Pfam: FMO-like Pyr_redox_3 K_oxygenase Pyr_redox_2 DAO NAD_binding_8 Pyr_redox NAD_binding_9 AlaDh_PNT_C
Other DBs
NCBI-GeneID: 2326
NCBI-ProteinID: NP_001269622
OMIM: 136130
HGNC: 3769
Ensembl: ENSG00000010932
Vega: OTTHUMG00000035502
Pharos: Q01740(Tbio)
UniProt: Q01740 A0A024R934 B2RCG5
LinkDB
Position
1q24.3
AA seq 532 aa
MAKRVAIVGAGVSGLASIKCCLEEGLEPTCFERSDDLGGLWRFTEHVEEGRASLYKSVVS
NSCKEMSCYSDFPFPEDYPNYVPNSQFLEYLKMYANHFDLLKHIQFKTKVCSVTKCSDSA
VSGQWEVVTMHEEKQESAIFDAVMVCTGFLTNPYLPLDSFPGINAFKGQYFHSRQYKHPD
IFKDKRVLVIGMGNSGTDIAVEASHLAEKVFLSTTGGGWVISRIFDSGYPWDMVFMTRFQ
NMLRNSLPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIR
PSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDGQASLYKYIFPAH
LQKPTLAIIGLIKPLGSMIPTGETQARWAVRVLKGVNKLPPPSVMIEEINARKENKPSWF
GLCYCKALQSDYITYIDELLTYINAKPNLFSMLLTDPHLALTVFFGPCSPYQFRLTGPGK
WEGARNAIMTQWDRTFKVIKARVVQESPSPFESFLKVFSFLALLVAIFLIFL
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggccaagcgagttgccattgtgggagctggggtcagcggcctggcctccatcaagtgc
tgtctggaagaaggactggagcccacctgctttgagaggagcgatgaccttggggggctg
tggagattcaccgaacatgttgaagaaggcagagccagtctctacaagtctgtggtttcc
aacagctgcaaggagatgtcttgttactcagactttccattcccagaagattatccaaac
tatgtgccaaattctcaattcctggaatatctcaaaatgtatgcaaaccactttgacctt
ctgaaacacattcaattcaagaccaaagtctgcagtgtaacaaaatgctcagattctgct
gtctctggccaatgggaggtggtcactatgcatgaagagaagcaagagtcagccatcttt
gatgctgtcatggtctgcactggctttcttactaatccttatttgccactggattccttt
ccaggtattaatgcctttaaaggccagtactttcatagccggcaatataagcatccagat
atatttaaggacaagagagtccttgtgattggaatgggaaattctggcacagacattgct
gtggaggccagccacctggcggaaaaggtgttcctcagcaccaccggagggggatgggtg
atcagccgaatctttgactcgggctacccatgggacatggtgttcatgacacgctttcag
aacatgttgagaaattccctcccaaccccaattgtgacttggttgatggagcgaaagata
aacaactggctcaatcatgcaaattacggcttaataccagaagacaggactcagctgaaa
gagtttgtgctaaatgatgagctcccaggacgcatcatcactgggaaagtgttcatcagg
ccaagcataaaagaggtaaaggaaaactctgtcatatttaacaatacttcaaaggaagag
cctattgacatcattgtctttgccactggatacacatttgctttccccttccttgatgag
tctgtagtgaaagttgaagatggccaggcctcactgtacaagtatatcttccctgcacat
ctgcaaaagccaaccctggccattattggcctcatcaaacccttgggctccatgatacct
acaggagaaacacaagctcggtgggctgttcgagtcctgaaaggtgtaaataagttacca
ccaccaagtgtcatgatagaggaaattaatgcaaggaaagaaaacaagcccagttggttt
ggcttgtgctactgcaaggctttacaatcagattatatcacatacatagatgaactcctg
acctatatcaatgcaaaacccaacctgttctctatgctcctaacggatccacatctggct
ctgaccgtcttctttggcccatgctcaccataccagttccgcttgactggcccaggaaaa
tgggaaggagccagaaatgccatcatgacccagtgggaccgaacattcaaggtcatcaaa
gctcgagttgtacaagagtctccatctccctttgaaagttttcttaaagtctttagcttt
ctggctttgcttgtggctatttttctgattttcctataa

DBGET integrated database retrieval system