KEGG   Homo sapiens (human): 2328Help
Entry
2328              CDS       T01001                                 

Gene name
FMO3, FMOII, TMAU, dJ127D3.1
Definition
(RefSeq) flavin containing dimethylaniline monoxygenase 3
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00982  Drug metabolism - cytochrome P450
Disease
H01234  Trimethylaminuria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    2328 (FMO3)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     2328 (FMO3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FMO-like Pyr_redox_3 Pyr_redox_2 K_oxygenase NAD_binding_8 Pyr_redox DAO NAD_binding_9 Shikimate_DH AlaDh_PNT_C
Motif
Other DBs
NCBI-GeneID: 2328
NCBI-ProteinID: NP_001002294
OMIM: 136132
HGNC: 3771
Ensembl: ENSG00000007933
Vega: OTTHUMG00000035505
Pharos: P31513(Tbio)
UniProt: P31513 A0A024R8Z4 Q53FW5
LinkDB All DBs
Position
1q24.3
AA seq 532 aa AA seqDB search
MGKKVAIIGAGVSGLASIRSCLEEGLEPTCFEKSNDIGGLWKFSDHAEEGRASIYKSVFS
NSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFA
TTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPKESFPGLNHFKGKCFHSRDYKEPG
VFNGKRVLVVGLGNSGCDIATELSRTAEQVMISSRSGSWVMSRVWDNGYPWDMLLVTRFG
TFLKNNLPTAISDWLYVKQMNARFKHENYGLMPLNGVLRKEPVFNDELPASILCGIVSVK
PNVKEFTETSAIFEDGTIFEGIDCVIFATGYSFAYPFLDESIIKSRNNEIILFKGVFPPL
LEKSTIAVIGFVQSLGAAIPTVDLQSRWAAQVIKGTCTLPSMEDMMNDINEKMEKKRKWF
GKSETIQTDYIVYMDELSSFIGAKPNIPWLFLTDPKLAMEVYFGPCSPYQFRLVGPGQWP
GARNAILTQWDRSLKPMQTRVVGRLQKPCFFFHWLKLFAIPILLIAVFLVLT
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggggaagaaagtggccatcattggagctggtgtgagtggcttggcctccatcaggagc
tgtctggaagaggggctggagcccacctgctttgagaagagcaatgacattgggggcctg
tggaaattttcagaccatgcagaggagggcagggctagcatttacaaatcagtcttttcc
aactcttccaaagagatgatgtgtttcccagacttcccatttcccgatgacttccccaac
tttatgcacaacagcaagatccaggaatatatcattgcatttgccaaagaaaagaacctc
ctgaagtacatacaatttaagacatttgtatccagtgtaaataaacatcctgattttgca
actactggccagtgggatgttaccactgaaagggatggtaaaaaagaatcggctgtcttt
gatgctgtaatggtttgttccggacatcatgtgtatcccaacctaccaaaagagtccttt
ccaggactaaaccactttaaaggcaaatgcttccacagcagggactataaagaaccaggt
gtattcaatggaaagcgtgtcctggtggttggcctggggaattcgggctgtgatattgcc
acagaactcagccgcacagcagaacaggtcatgatcagttccagaagtggctcctgggtg
atgagccgggtctgggacaatggttatccttgggacatgctgctcgtcactcgatttgga
accttcctcaagaacaatttaccgacagccatctctgactggttgtacgtgaagcagatg
aatgcaagattcaagcatgaaaactatggcttgatgcctttaaatggagtcctgaggaaa
gagcctgtatttaacgatgagctcccagcaagcattctgtgtggcattgtgtccgtaaag
cctaacgtgaaggaattcacagagacctcggccatttttgaggatgggaccatatttgag
ggcattgactgtgtaatctttgcaacagggtatagttttgcctaccccttccttgatgag
tctatcatcaaaagcagaaacaatgagatcattttatttaaaggagtatttcctcctcta
cttgagaagtcaaccatagcagtgattggctttgtccagtcccttggggctgccattccc
acagttgacctccagtcccgctgggcagcacaagtaataaagggaacttgtactttgcct
tctatggaagacatgatgaatgatattaatgagaaaatggagaaaaagcgcaaatggttt
ggcaaaagcgagaccatacagacagattacattgtttatatggatgaactctcctccttc
attggggcaaagcccaacatcccatggctgtttctcacagatcccaaattggccatggaa
gtttattttggcccttgtagtccctaccagtttaggctggtgggcccagggcagtggcca
ggagccagaaatgccatactgacccagtgggaccggtcgttgaaacccatgcagacacga
gtggtcgggagacttcagaagccttgcttctttttccattggctgaagctctttgcaatt
cctattctgttaatcgctgttttccttgtgttgacctaa

DBGET integrated database retrieval system