KEGG   Homo sapiens (human): 2329
Entry
2329              CDS       T01001                                 

Gene name
FMO4, FMO2
Definition
(RefSeq) flavin containing dimethylaniline monoxygenase 4
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00982  Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    2329 (FMO4)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     2329 (FMO4)
SSDB
Motif
Pfam: FMO-like Pyr_redox_3 K_oxygenase Pyr_redox_2 DAO NAD_binding_8 NAD_binding_9 Shikimate_DH 2-Hacid_dh_C AlaDh_PNT_C
Other DBs
NCBI-GeneID: 2329
NCBI-ProteinID: NP_002013
OMIM: 136131
HGNC: 3772
Ensembl: ENSG00000076258
Vega: OTTHUMG00000035506
Pharos: P31512(Tdark)
UniProt: P31512
LinkDB
Position
1q24.3
AA seq 558 aa
MAKKVAVIGAGVSGLSSIKCCVDEDLEPTCFERSDDIGGLWKFTESSKDGMTRVYKSLVT
NVCKEMSCYSDFPFHEDYPNFMNHEKFWDYLQEFAEHFDLLKYIQFKTTVCSITKRPDFS
ETGQWDVVTETEGKQNRAVFDAVMVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPE
GFQGKRVLVIGLGNTGGDIAVELSRTAAQVLLSTRTGTWVLGRSSDWGYPYNMMVTRRCC
SFIAQVLPSRFLNWIQERKLNKRFNHEDYGLSITKGKKAKFIVNDELPNCILCGAITMKT
SVIEFTETSAVFEDGTVEENIDVVIFTTGYTFSFPFFEEPLKSLCTKKIFLYKQVFPLNL
ERATLAIIGLIGLKGSILSGTELQARWVTRVFKGLCKIPPSQKLMMEATEKEQLIKRGVF
KDTSKDKFDYIAYMDDIAACIGTKPSIPLLFLKDPRLAWEVFFGPCTPYQYRLMGPGKWD
GARNAILTQWDRTLKPLKTRIVPDSSKPASMSHYLKAWGAPVLLASLLLICKSSLFLKLV
RDKLQDRMSPYLVSLWRG
NT seq 1677 nt   +upstreamnt  +downstreamnt
atggccaagaaagttgcagtgattggagctggtgtgagtggcctctcctccatcaaatgc
tgtgtggatgaggacctggagcccacctgctttgagagaagtgatgacattgggggatta
tggaagtttactgaatcttccaaagatgggatgaccagggtctataagtcattagtgaca
aatgtctgtaaggaaatgtcatgttacagtgacttccctttccacgaagattatcctaat
ttcatgaaccatgaaaaattttgggactatctccaagaatttgctgagcactttgacctc
ctgaaatacattcagtttaagaccactgtgtgcagcataacgaagcgtccagacttctcc
gaaactggtcagtgggatgttgtcacagagacagagggcaagcaaaatagagctgtcttt
gatgctgttatggtttgcactggacatttcctgaatccccatttacctttggaagccttt
cctggaattcataagtttaaaggtcagatcctgcatagtcaagagtacaagatcccagaa
ggctttcagggcaaacgcgtcttggtgattggtcttgggaacactggaggagacattgct
gtggaactcagtcgaacggcagctcaggtacttctcagtactagaactggtacctgggtt
cttgggcgctcttcagattggggctatccttataatatgatggttacaagaagatgctgt
agttttattgcacaagttctgccttcacgttttctaaactggattcaagaaaggaagttg
aataagagatttaatcatgaggattatggattaagtattaccaaagggaaaaaagcaaaa
ttcattgtgaatgatgagctgccaaactgtatcctctgtggggcaatcactatgaaaacc
agcgtgattgaatttacagaaacctctgctgtctttgaagatgggacagtggaagaaaac
attgatgttgtgatcttcactacaggatatacattttcttttccattttttgaagaacct
cttaaaagcctctgtacaaagaagatatttctatacaagcaagtctttcccttaaaccta
gagagagcgacattagccatcatcggccttatcggccttaaaggatccatcttatcaggc
acagagctccaagcacgatgggtcacaagagtattcaaaggactctgtaagatacctcca
tcccaaaaattgatgatggaggctactgaaaaggaacagctcattaaaaggggagtgttt
aaagacaccagcaaagacaaatttgactacattgcctacatggatgatatcgctgcctgc
ataggcacaaagcccagcatcccacttctgttcctcaaggatcccagactagcttgggaa
gttttctttggaccatgtactccttatcagtaccgcctcatgggccctggaaaatgggat
ggagccagaaatgccatcctgacccagtgggacagaacattgaaacctttaaaaactcga
attgtccctgattcctccaagcctgcctccatgtcacattatttaaaagcctggggggca
cctgtcctacttgcctctcttctacttatctgtaaatcttcacttttcttgaaattggtg
agagataaactacaggacagaatgtccccttacctagtaagtctttggcgaggatga

DBGET integrated database retrieval system