KEGG   Homo sapiens (human): 2330
Entry
2330              CDS       T01001                                 

Gene name
FMO5, hBVMO1
Definition
(RefSeq) flavin containing dimethylaniline monoxygenase 5
  KO
K00485  dimethylaniline monooxygenase (N-oxide forming) [EC:1.14.13.8]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00982  Drug metabolism - cytochrome P450
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    2330 (FMO5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.8  flavin-containing monooxygenase
     2330 (FMO5)
SSDB
Motif
Pfam: FMO-like Pyr_redox_3 K_oxygenase Pyr_redox_2 DAO NAD_binding_8 Prenylcys_lyase
Other DBs
NCBI-GeneID: 2330
NCBI-ProteinID: NP_001452
OMIM: 603957
HGNC: 3773
Ensembl: ENSG00000131781
Vega: OTTHUMG00000014607
Pharos: P49326(Tbio)
UniProt: P49326 A0A024QYY6
LinkDB
Position
1q21.1
AA seq 533 aa
MTKKRIAVIGGGVSGLSSIKCCVEEGLEPVCFERTDDIGGLWRFQENPEEGRASIYKSVI
INTSKEMMCFSDYPIPDHYPNFMHNAQVLEYFRMYAKEFDLLKYIRFKTTVCSVKKQPDF
ATSGQWEVVTESEGKKEMNVFDGVMVCTGHHTNAHLPLESFPGIEKFKGQYFHSRDYKNP
EGFTGKRVIIIGIGNSGGDLAVEISQTAKQVFLSTRRGAWILNRVGDYGYPADVLFSSRL
THFIWKICGQSLANKYLEKKINQRFDHEMFGLKPKHRALSQHPTLNDDLPNRIISGLVKV
KGNVKEFTETAAIFEDGSREDDIDAVIFATGYSFDFPFLEDSVKVVKNKISLYKKVFPPN
LERPTLAIIGLIQPLGAIMPISELQGRWATQVFKGLKTLPSQSEMMAEISKAQEEIDKRY
VESQRHTIQGDYIDTMEELADLVGVRPNLLSLAFTDPKLALHLLLGPCTPIHYRVQGPGK
WDGARKAILTTDDRIRKPLMTRVVERSSSMTSTMTIGKFMLALAFFAIIIAYF
NT seq 1602 nt   +upstreamnt  +downstreamnt
atgactaagaaaagaattgctgtgattgggggaggagtgagcgggctctcttccatcaag
tgctgcgtagaagaaggcttggaacctgtctgctttgaaaggactgatgacatcggaggg
ctctggaggttccaggaaaatcctgaagaaggaagggccagtatttacaaatcagtgatc
atcaatacttctaaagagatgatgtgcttcagtgactatccaatcccagatcattatccc
aacttcatgcataatgcccaggtcctggagtatttcaggatgtatgccaaagaatttgac
cttctaaagtatattcgatttaagaccactgtgtgcagtgtgaagaagcagcctgatttt
gccacttcaggccaatgggaagtggtcactgaatctgaagggaaaaaggagatgaatgtc
tttgatggagtcatggtttgcactggccatcacaccaatgctcatctacctctggaaagc
ttccctggaattgagaagttcaaagggcagtacttccacagtcgagactataagaaccca
gagggattcactggaaagagagtcattataattggcattgggaattctggaggggatctg
gctgtagagattagccaaacagccaagcaggttttcctcagcaccaggagaggggcttgg
atcctgaatcgtgtaggggactacggatatcctgctgatgtgttgttctcttctcgactt
acacattttatatggaagatctgtggccaatcattagcaaacaaatatttggaaaaaaag
ataaaccaaaggtttgaccatgaaatgtttggcctgaagcctaaacacagagctctgagt
cagcatccaaccttaaatgatgacctgccaaatcgtatcatttctggcttggtgaaagtg
aaaggaaatgtgaaggaattcacggagacagctgccatatttgaggatggctccagggag
gatgacattgatgctgttatctttgccacaggctatagctttgactttccatttctggaa
gattccgtcaaagtggtcaaaaacaagatatccctgtataaaaaggtcttccctcctaac
ctggaaaggccaactcttgcaatcataggcttgattcagcccttaggagccattatgccc
atttcagagctccaaggacgctgggccactcaggtatttaaaggtctaaagacattgccc
tcacagagtgaaatgatggcagaaatatctaaagctcaagaggaaattgacaaaaggtat
gtggagagccaacgccataccattcagggagactacatagataccatggaagagcttgct
gatttggtgggggtcaggcccaatctgctgtctctggccttcactgaccccaagctggca
ttacacttattactgggaccctgcactccaatccactatcgtgtacagggccctggaaag
tgggatggggctcgaaaagctatcctcaccacagatgatcgcatcaggaagcctctgatg
acaagagtagttgaaaggagtagttctatgacttcaacaatgacaataggcaagtttatg
ctagctcttgccttctttgctataattatagcttacttctag

DBGET integrated database retrieval system