KEGG   Homo sapiens (human): 23308Help
Entry
23308             CDS       T01001                                 

Gene name
ICOSLG, B7-H2, B7H2, B7RP-1, B7RP1, CD275, GL50, ICOS-L, ICOSL, LICOS
Definition
(RefSeq) inducible T cell costimulator ligand
  KO
K06710  inducible T-cell co-stimulator ligand
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    23308 (ICOSLG)
 Organismal Systems
  Immune system
   04672 Intestinal immune network for IgA production
    23308 (ICOSLG)
CD molecules [BR:hsa04090]
 Proteins
  23308 (ICOSLG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: V-set Ig_3 I-set C2-set_2 ig
Motif
Other DBs
NCBI-GeneID: 23308
NCBI-ProteinID: NP_056074
OMIM: 605717
HGNC: 17087
Ensembl: ENSG00000160223
Vega: OTTHUMG00000086920
Pharos: O75144(Tbio)
UniProt: O75144 A0N0L8
LinkDB All DBs
Position
21q22.3
AA seq 302 aa AA seqDB search
MRLGSPGLLFLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLENVDSRYRNRALMSPAGMLRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERD
KITENPVSTGEKNAATWSILAVLCLLVVVAVAIGWVCRDRCLQHSYAGAWAVSPETELTG
HV
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcggctgggcagtcctggactgctcttcctgctcttcagcagccttcgagctgatact
caggagaaggaagtcagagcgatggtaggcagcgacgtggagctcagctgcgcttgccct
gaaggaagccgttttgatttaaatgatgtttacgtatattggcaaaccagtgagtcgaaa
accgtggtgacctaccacatcccacagaacagctccttggaaaacgtggacagccgctac
cggaaccgagccctgatgtcaccggccggcatgctgcggggcgacttctccctgcgcttg
ttcaacgtcaccccccaggacgagcagaagtttcactgcctggtgttgagccaatccctg
ggattccaggaggttttgagcgttgaggttacactgcatgtggcagcaaacttcagcgtg
cccgtcgtcagcgccccccacagcccctcccaggatgagctcaccttcacgtgtacatcc
ataaacggctaccccaggcccaacgtgtactggatcaataagacggacaacagcctgctg
gaccaggctctgcagaatgacaccgtcttcttgaacatgcggggcttgtatgacgtggtc
agcgtgctgaggatcgcacggacccccagcgtgaacattggctgctgcatagagaacgtg
cttctgcagcagaacctgactgtcggcagccagacaggaaatgacatcggagagagagac
aagatcacagagaatccagtcagtaccggcgagaaaaacgcggccacgtggagcatcctg
gctgtcctgtgcctgcttgtggtcgtggcggtggccataggctgggtgtgcagggaccga
tgcctccaacacagctatgcaggtgcctgggctgtgagtccggagacagagctcactggc
cacgtttga

DBGET integrated database retrieval system