KEGG   Homo sapiens (human): 23373
Entry
23373             CDS       T01001                                 

Gene name
CRTC1, MAML2, MECT1, Mam-2, TORC-1, TORC1, WAMTP1
Definition
(RefSeq) CREB regulated transcription coactivator 1
  KO
K15309  CREB-regulated transcription coactivator 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05166  Human T-cell leukemia virus 1 infection
Disease
H01508  Salivary gland cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    23373 (CRTC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    23373 (CRTC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    23373 (CRTC1)
SSDB
Motif
Pfam: TORC_M TORC_C TORC_N
Other DBs
NCBI-GeneID: 23373
NCBI-ProteinID: NP_056136
OMIM: 607536
HGNC: 16062
Ensembl: ENSG00000105662
Vega: OTTHUMG00000183115
Pharos: Q6UUV9(Tbio)
UniProt: Q6UUV9
LinkDB
Position
19p13.11
AA seq 634 aa
MATSNNPRKFSEKIALHNQKQAEETAAFEEVMKDLSLTRAARLQLQKSQYLQLGPSRGQY
YGGSLPNVNQIGSGTMDLPFQTPFQSSGLDTSRTTRHHGLVDRVYRERGRLGSPHRRPLS
VDKHGRQADSCPYGTMYLSPPADTSWRRTNSDSALHQSTMTPTQPESFSSGSQDVHQKRV
LLLTVPGMEETTSEADKNLSKQAWDTKKTGSRPKSCEVPGINIFPSADQENTTALIPATH
NTGGSLPDLTNIHFPSPLPTPLDPEEPTFPALSSSSSTGNLAANLTHLGIGGAGQGMSTP
GSSPQHRPAGVSPLSLSTEARRQQASPTLSPLSPITQAVAMDALSLEQQLPYAFFTQAGS
QQPPPQPQPPPPPPPASQQPPPPPPPQAPVRLPPGGPLLPSASLTRGPQPPPLAVTVPSS
LPQSPPENPGQPSMGIDIASAPALQQYRTSAGSPANQSPTSPVSNQGFSPGSSPQHTSTL
GSVFGDAYYEQQMAARQANALSHQLEQFNMMENAISSSSLYSPGSTLNYSQAAMMGLTGS
HGSLPDSQQLGYASHSGIPNIILTVTGESPPSLSKELTSSLAGVGDVSFDSDSQFPLDEL
KIDPLTLDGLHMLNDPDMVLADPATEDTFRMDRL
NT seq 1905 nt   +upstreamnt  +downstreamnt
atggcgacttcgaacaatccgcggaaattcagcgagaagatcgcgctgcacaatcagaag
caggcggaggagacggcggccttcgaggaggtcatgaaggacctgagcctgacgcgggcc
gcgcggctccagctccagaaatcccagtacctgcaactgggccccagccgaggccagtac
tatggcgggtccctgcccaacgtgaaccagatcgggagtggcaccatggacctgcccttc
cagacccccttccaatcctcgggcctggacaccagccggaccacccggcaccatgggctg
gtggacagggtgtaccgggagcgtggccggctcggctccccacaccgccggcccctgtca
gtggacaaacacggacggcaggccgacagctgcccctatggcaccatgtacctctcacca
cccgcggacaccagctggagaaggaccaattctgactccgccctgcaccagagcacaatg
acgcccacgcagccagaatcctttagcagtgggtcccaggacgtgcaccagaaaagagtc
ttactgttaacagtcccaggaatggaagagaccacatcagaggcagacaaaaacctttcc
aagcaagcatgggacaccaagaagacggggtccaggcccaagtcctgtgaggtccccgga
atcaacatcttcccgtctgccgaccaggaaaacactacagccctgatccccgccacccac
aacacaggggggtccctgcccgacctgaccaacatccacttcccctccccgctcccgacc
ccgctggaccccgaggagcccaccttccctgcactgagcagctccagcagcaccggcaac
ctcgcggccaacctgacgcacctgggcatcggtggcgccggccagggaatgagcacacct
ggctcctctccacagcaccgcccagctggcgtcagccccctgtccctgagcacagaggca
aggcgtcagcaggcatcgcccaccctgtccccgctgtcacccatcactcaggctgtagcc
atggacgccctgtctctggagcagcagctgccctacgccttcttcacccaggcgggctcc
cagcagccaccgccgcagccccagcccccgccgcctcctccacccgcgtcccagcagcca
ccacccccgccacccccacaggcgcccgtccgcctgccccctggtggccccctgttgccc
agcgccagcctgactcgtgggccacagccgcccccgcttgcagtcacggtaccgtcctct
ctcccccagtcccccccagagaaccctggccagccatcgatggggatcgacatcgcctcg
gcgccggctctgcagcagtaccgcactagcgccggctccccggccaaccagtctcccacc
tcgccagtctccaatcaaggcttctccccagggagctccccgcaacacacttccaccctg
ggcagcgtgtttggggacgcgtactatgagcagcagatggcggccaggcaggccaatgct
ctgtcccaccagctggagcagttcaacatgatggagaacgccatcagctccagcagcctg
tacagcccgggctccacactcaactactcgcaggcggccatgatgggcctcacgggcagc
cacgggagcctgccggactcgcagcaactgggatacgccagccacagtggcatccccaac
atcatcctcacagtgacaggagagtccccccccagcctctctaaagaactgaccagctct
ctggccggggtcggcgacgtcagcttcgactccgacagccagtttcccctggacgaactc
aagatcgaccccctgaccctcgacggactgcacatgctcaacgaccccgacatggttctg
gccgacccagccaccgaggacaccttccggatggaccgcctgtga

DBGET integrated database retrieval system