KEGG   Homo sapiens (human): 23382Help
Entry
23382             CDS       T01001                                 

Gene name
AHCYL2, ADOHCYASE3, IRBIT2
Definition
(RefSeq) adenosylhomocysteinase like 2
  KO
K01251  adenosylhomocysteinase [EC:3.3.1.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00270  Cysteine and methionine metabolism
hsa01100  Metabolic pathways
Module
hsa_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    23382 (AHCYL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    23382 (AHCYL2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23382 (AHCYL2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     23382 (AHCYL2)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     23382 (AHCYL2)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   23382 (AHCYL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AdoHcyase AdoHcyase_NAD 2-Hacid_dh_C THF_DHG_CYH_C Shikimate_DH IlvN NAD_binding_7 TrkA_N AlaDh_PNT_C SR-25
Motif
Other DBs
NCBI-GeneID: 23382
NCBI-ProteinID: NP_056143
OMIM: 616520
HGNC: 22204
Ensembl: ENSG00000158467
Vega: OTTHUMG00000157677
Pharos: Q96HN2(Tdark)
UniProt: Q96HN2
LinkDB All DBs
Structure
PDB: 

Position
7q32.1
AA seq 611 aa AA seqDB search
MSVQVVSAAAAAKVPEVELKDLSPSEAESQLGLSTAAVGAMAPPAGGGDPEAPAPAAERP
PVPGPGSGPAAALSPAAGKVPQASAMKRSDPHHQHQRHRDGGEALVSPDGTVTEAPRTVK
KQIQFADQKQEFNKRPTKIGRRSLSRSISQSSTDSYSSAASYTDSSDDETSPRDKQQKNS
KGSSDFCVKNIKQAEFGRREIEIAEQEMPALMALRKRAQGEKPLAGAKIVGCTHITAQTA
VLMETLGALGAQCRWAACNIYSTLNEVAAALAESGFPVFAWKGESEDDFWWCIDRCVNVE
GWQPNMILDDGGDLTHWIYKKYPNMFKKIKGIVEESVTGVHRLYQLSKAGKLCVPAMNVN
DSVTKQKFDNLYCCRESILDGLKRTTDMMFGGKQVVVCGYGEVGKGCCAALKAMGSIVYV
TEIDPICALQACMDGFRLVKLNEVIRQVDIVITCTGNKNVVTREHLDRMKNSCIVCNMGH
SNTEIDVASLRTPELTWERVRSQVDHVIWPDGKRIVLLAEGRLLNLSCSTVPTFVLSITA
TTQALALIELYNAPEGRYKQDVYLLPKKMDEYVASLHLPTFDAHLTELTDEQAKYLGLNK
NGPFKPNYYRY
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtgcaggttgtgtcagccgcggctgccgccaaggtgcctgaggtggagctgaag
gacctgagcccctccgaggcggagtcgcaactaggactgagcacggccgccgtgggcgcc
atggcccccccggcgggcggtggagaccctgaggctccagctcccgccgcggagcggccc
ccggtccccggcccgggctcggggcccgccgccgctctcagccccgccgccgggaaggtg
cctcaggcgtcggccatgaagcggagcgacccacatcaccagcaccagcggcaccgcgac
ggcggcgaggccctggtcagccccgacggcaccgtcaccgaggcgccgcgcacagtcaag
aagcagatccagtttgctgaccagaagcaagaattcaacaaacgtcccaccaaaattgga
cgtcgctctttgtctcgttccatttctcagtcatctactgacagctacagctcagcggct
tcatatacagatagctctgatgatgagacatcgcccagggacaagcagcaaaagaactct
aagggaagcagtgacttctgtgttaagaacatcaaacaggcagagtttggacgaagagaa
attgaaattgctgaacaagaaatgcctgcattgatggctttgaggaagagagctcaagga
gaaaagcctttggctggagccaaaatcgtgggttgcacacacatcactgctcagactgct
gtgcttatggaaactctgggtgctctgggggcccagtgccgatgggctgcctgcaacatc
tattccactctcaatgaagtggctgctgctctagcagaaagtggatttcctgtttttgcc
tggaagggagagtcagaagatgacttttggtggtgtatcgatagatgtgtgaatgtggag
ggctggcagccaaacatgatcttggatgatggaggggatcttacccactggatttataaa
aagtatcccaacatgtttaagaaaatcaagggcatagtagaggagagtgttactggagtt
cacaggctgtaccaactgtccaaagctgggaagctgtgtgttccagccatgaatgtcaat
gactcagtcaccaaacagaaatttgacaacctctactgttgccgtgaatcaattcttgat
ggacttaaaaggacaacagacatgatgtttggtggaaagcaagtggtagtctgtggctat
ggagaggtggggaaagggtgctgtgctgccctgaaagccatgggctccattgtgtatgta
actgaaattgaccccatctgtgccctgcaagcctgtatggatggatttcgactggtgaaa
ttaaatgaggtcatccgacaagtggacattgttattacctgtacaggtaacaagaatgtg
gtaaccagagagcacttggaccgtatgaagaatagctgcatcgtttgtaacatgggacat
tccaacacagagattgacgtggcgagtctgcggacaccagaactgacctgggagcgagtg
agatctcaagttgaccatgtgatatggcctgatggcaagaggatagtactgctggcagag
ggccgcctgctgaaccttagctgctccacagtgcctacatttgtgctctcaatcactgct
actactcaggctcttgccttgatagagctttacaatgctcctgagggtcgctataagcag
gatgtctacctgttgcccaagaagatggatgagtatgtggccagcctacacctgcctacc
tttgatgcccacttgacagagctgacagatgaacaggccaagtatctgggactcaacaag
aatgggcccttcaagcctaattactacaggtattaa

DBGET integrated database retrieval system