KEGG   Homo sapiens (human): 23385Help
Entry
23385             CDS       T01001                                 

Gene name
NCSTN, ATAG1874
Definition
(RefSeq) nicastrin
  KO
K06171  nicastrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04330  Notch signaling pathway
hsa05010  Alzheimer disease
Disease
H00681  Acne inversa
Drug target
Avagacestat: D09869
Begacestat: D08869
Crenigacestat: D11151
Nirogacestat (DG03016): D10960 D11453
Semagacestat: D09377
Tarenflurbil: D09010
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    23385 (NCSTN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    23385 (NCSTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nicastrin Ncstrn_small Peptidase_M28
Motif
Other DBs
NCBI-GeneID: 23385
NCBI-ProteinID: NP_056146
OMIM: 605254
HGNC: 17091
Ensembl: ENSG00000162736
Vega: OTTHUMG00000033110
Pharos: Q92542(Tbio)
UniProt: Q92542
LinkDB All DBs
Structure
PDB: 

Position
1q23.2
AA seq 709 aa AA seqDB search
MATAGGGSGADPGSRGLLRLLSFCVLLAGLCRGNSVERKIYIPLNKTAPCVRLLNATHQI
GCQSSISGDTGVIHVVEKEEDLQWVLTDGPNPPYMVLLESKHFTRDLMEKLKGRTSRIAG
LAVSLTKPSPASGFSPSVQCPNDGFGVYSNSYGPEFAHCREIQWNSLGNGLAYEDFSFPI
FLLEDENETKVIKQCYQDHNLSQNGSAPTFPLCAMQLFSHMHAVISTATCMRRSSIQSTF
SINPEIVCDPLSDYNVWSMLKPINTTGTLKPDDRVVVAATRLDSRSFFWNVAPGAESAVA
SFVTQLAAAEALQKAPDVTTLPRNVMFVFFQGETFDYIGSSRMVYDMEKGKFPVQLENVD
SFVELGQVALRTSLELWMHTDPVSQKNESVRNQVEDLLATLEKSGAGVPAVILRRPNQSQ
PLPPSSLQRFLRARNISGVVLADHSGAFHNKYYQSIYDTAENINVSYPEWLSPEEDLNFV
TDTAKALADVATVLGRALYELAGGTNFSDTVQADPQTVTRLLYGFLIKANNSWFQSILRQ
DLRSYLGDGPLQHYIAVSSPTNTTYVVQYALANLTGTVVNLTREQCQDPSKVPSENKDLY
EYSWVQGPLHSNETDRLPRCVRSTARLARALSPAFELSQWSSTEYSTWTESRWKDIRARI
FLIASKELELITLTVGFGILIFSLIVTYCINAKADVLFIAPREPGAVSY
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggctacggcagggggtggctctggggctgacccgggaagtcggggtctccttcgcctt
ctgtctttctgcgtcctactagcaggtttgtgcaggggaaactcagtggagaggaagata
tatatccccttaaataaaacagctccctgtgttcgcctgctcaacgccactcatcagatt
ggctgccagtcttcaattagtggagacacaggggttatccacgtagtagagaaagaggag
gacctacagtgggtattgactgatggccccaaccccccttacatggttctgctggagagc
aagcattttaccagggatttaatggagaagctgaaagggagaaccagccgaattgctggt
cttgcagtgtccttgaccaagcccagtcctgcctcaggcttctctcctagtgtacagtgc
ccaaatgatgggtttggtgtttactccaattcctatgggccagagtttgctcactgcaga
gaaatacagtggaattcgctgggcaatggtttggcttatgaagactttagtttccccatc
tttcttcttgaagatgaaaatgaaaccaaagtcatcaagcagtgctatcaagatcacaac
ctgagtcagaatggctcagcaccaaccttcccactatgtgccatgcagctcttttcacac
atgcatgctgtcatcagcactgccacctgcatgcggcgcagctccatccaaagcaccttc
agcatcaacccagaaatcgtctgtgaccccctgtctgattacaatgtgtggagcatgcta
aagcctataaatacaactgggacattaaagcctgacgacagggttgtggttgctgccacc
cggctggatagtcgttcctttttctggaatgtggccccaggggctgaaagcgcagtggct
tcctttgtcacccagctggctgctgctgaagctttgcaaaaggcacctgatgtgaccacc
ctgccccgcaatgtcatgtttgtcttctttcaaggggaaacttttgactacattggcagc
tcgaggatggtctacgatatggagaagggcaagtttcccgtgcagttagagaatgttgac
tcatttgtggagctgggacaggtggccttaagaacttcattagagctttggatgcacaca
gatcctgtttctcagaaaaatgagtctgtacggaaccaggtggaggatctcctggccaca
ttggagaagagtggtgctggtgtccctgctgtcatcctcaggaggccaaatcagtcccag
cctctcccaccatcttccctgcagcgatttcttcgagctcgaaacatctctggcgttgtt
ctggctgaccactctggtgccttccataacaaatattaccagagtatttacgacactgct
gagaacattaatgtgagctatcccgaatggctgagccctgaagaggacctgaactttgta
acagacactgccaaggccctggcagatgtggccacggtgctgggacgtgctctgtatgag
cttgcaggaggaaccaacttcagcgacacagttcaggctgatccccaaacggttacccgc
ctgctctatgggttcctgattaaagccaacaactcatggttccagtctatcctcaggcag
gacctaaggtcctacttgggtgacgggcctcttcaacattacatcgctgtctccagcccc
accaacaccacttatgttgtacagtatgccttggcaaatttgactggcacagtggtcaac
ctcacccgagagcagtgccaggatccaagtaaagtcccaagtgaaaacaaggatctgtat
gagtactcatgggtccagggccctttgcattctaatgagacggaccgactcccccggtgt
gtgcgttctactgcacgattagccagggccttgtctcctgcctttgaactgagtcagtgg
agctctactgaatactctacatggactgagagccgctggaaagatatccgtgcccggata
tttctcatcgccagcaaagagcttgagttgatcaccctgacagtgggcttcggcatcctc
atcttctccctcatcgtcacctactgcatcaatgccaaagctgatgtccttttcattgct
ccccgggagccaggagctgtgtcatactga

DBGET integrated database retrieval system