KEGG   Homo sapiens (human): 23410Help
Entry
23410             CDS       T01001                                 

Gene name
SIRT3, SIR2L3
Definition
(RefSeq) sirtuin 3
  KO
K11413  NAD+-dependent protein deacetylase sirtuin 3 [EC:2.3.1.286]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00760  Nicotinate and nicotinamide metabolism
hsa01100  Metabolic pathways
hsa05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    23410 (SIRT3)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    23410 (SIRT3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    23410 (SIRT3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.286  protein acetyllysine N-acetyltransferase
     23410 (SIRT3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   HDACs (histone deacetylases)
    SIRTs (sirtuins, class III HDACs)
     23410 (SIRT3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SIR2 Rad50_zn_hook
Motif
Other DBs
NCBI-GeneID: 23410
NCBI-ProteinID: NP_036371
OMIM: 604481
HGNC: 14931
Ensembl: ENSG00000142082
Vega: OTTHUMG00000119074
Pharos: Q9NTG7(Tchem)
UniProt: Q9NTG7
LinkDB All DBs
Structure
PDB: 

Position
11p15.5
AA seq 399 aa AA seqDB search
MAFWGWRAAAALRLWGRVVERVEAGGGVGPFQACGCRLVLGGRDDVSAGLRGSHGARGEP
LDPARPLQRPPRPEVPRAFRRQPRAAAPSFFFSSIKGGRRSISFSVGASSVVGSGGSSDK
GKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIF
ELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYTQNIDGLERVSGIP
ASKLVEAHGTFASATCTVCQRPFPGEDIRADVMADRVPRCPVCTGVVKPDIVFFGEPLPQ
RFLLHVVDFPMADLLLILGTSLEVEPFASLTEAVRSSVPRLLINRDLVGPLAWHPRSRDV
AQLGDVVHGVESLVELLGWTEEMRDLVQRETGKLDGPDK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctggggttggcgcgccgcggcagccctccggctgtggggccgggtagttgaa
cgggtcgaggccgggggaggcgtggggccgtttcaggcctgcggctgtcggctggtgctt
ggcggcagggacgatgtgagtgcggggctgagaggcagccatggggcccgcggtgagccc
ttggacccggcgcgccccttgcagaggcctcccagacccgaggtgcccagggcattccgg
aggcagccgagggcagcagctcccagtttcttcttttcgagtattaaaggtggaagaagg
tccatatctttttctgtgggtgcttcaagtgttgttggaagtggaggcagcagtgacaag
gggaagctttccctgcaggatgtagctgagctgattcgggccagagcctgccagagggtg
gtggtcatggtgggggccggcatcagcacacccagtggcattccagacttcagatcgccg
gggagtggcctgtacagcaacctccagcagtacgatctcccgtaccccgaggccattttt
gaactcccattcttctttcacaaccccaagccctttttcactttggccaaggagctgtac
cctggaaactacaagcccaacgtcactcactactttctccggctgcttcatgacaagggg
ctgcttctgcggctctacacgcagaacatcgatgggcttgagagagtgtcgggcatccct
gcctcaaagctggttgaagctcatggaacctttgcctctgccacctgcacagtctgccaa
agacccttcccaggggaggacattcgggctgacgtgatggcagacagggttccccgctgc
ccggtctgcaccggcgttgtgaagcccgacattgtgttctttggggagccgctgccccag
aggttcttgctgcatgtggttgatttccccatggcagatctgctgctcatccttgggacc
tccctggaggtggagccttttgccagcttgaccgaggccgtgcggagctcagttccccga
ctgctcatcaaccgggacttggtggggcccttggcttggcatcctcgcagcagggacgtg
gcccagctgggggacgtggttcacggcgtggaaagcctagtggagcttctgggctggaca
gaagagatgcgggaccttgtgcagcgggaaactgggaagcttgatggaccagacaaatag

DBGET integrated database retrieval system