KEGG   Homo sapiens (human): 23418Help
Entry
23418             CDS       T01001                                 

Gene name
CRB1, LCA8, RP12
Definition
(RefSeq) crumbs 1, cell polarity complex component
  KO
K16681  protein crumbs
Organism
hsa  Homo sapiens (human)
Pathway
hsa04390  Hippo signaling pathway
Disease
H00527  Retinitis pigmentosa (RP)
H00837  Leber congenital amaurosis (LCR)
H01088  Pigmented paravenous chorioretinal atrophy (PPCA)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    23418 (CRB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF Laminin_G_2 hEGF Laminin_G_1 EGF_CA EGF_3 EGF_2 Laminin_G_3 cEGF SH3_6
Motif
Other DBs
NCBI-GeneID: 23418
NCBI-ProteinID: NP_957705
OMIM: 604210
HGNC: 2343
Ensembl: ENSG00000134376
Vega: OTTHUMG00000035663
Pharos: P82279(Tbio)
UniProt: P82279
LinkDB All DBs
Position
1q31.3
AA seq 1406 aa AA seqDB search
MALKNINYLLIFYLSFSLLIYIKNSFCNKNNTRCLSNSCQNNSTCKDFSKDNDCSCSDTA
NNLDKDCDNMKDPCFSNPCQGSATCVNTPGERSFLCKCPPGYSGTICETTIGSCGKNSCQ
HGGICHQDPIYPVCICPAGYAGRFCEIDHDECASSPCQNGAVCQDGIDGYSCFCVPGYQG
RHCDLEVDECASDPCKNEATCLNEIGRYTCICPHNYSGVNCELEIDECWSQPCLNGATCQ
DALGAYFCDCAPGFLGDHCELNTDECASQPCLHGGLCVDGENRYSCNCTGSGFTGTHCET
LMPLCWSKPCHNNATCEDSVDNYTCHCWPGYTGAQCEIDLNECNSNPCQSNGECVELSSE
KQYGRITGLPSSFSYHEASGYVCICQPGFTGIHCEEDVNECSSNPCQNGGTCENLPGNYT
CHCPFDNLSRTFYGGRDCSDILLGCTHQQCLNNGTCIPHFQDGQHGFSCLCPSGYTGSLC
EIATTLSFEGDGFLWVKSGSVTTKGSVCNIALRFQTVQPMALLLFRSNRDVFVKLELLSG
YIHLSIQVNNQSKVLLFISHNTSDGEWHFVEVIFAEAVTLTLIDDSCKEKCIAKAPTPLE
SDQSICAFQNSFLGGLPVGMTSNGVALLNFYNMPSTPSFVGCLQDIKIDWNHITLENISS
GSSLNVKAGCVRKDWCESQPCQSRGRCINLWLSYQCDCHRPYEGPNCLREYVAGRFGQDD
STGYVIFTLDESYGDTISLSMFVRTLQPSGLLLALENSTYQYIRVWLERGRLAMLTPNSP
KLVVKFVLNDGNVHLISLKIKPYKIELYQSSQNLGFISASTWKIEKGDVIYIGGLPDKQE
TELNGGFFKGCIQDVRLNNQNLEFFPNPTNNASLNPVLVNVTQGCAGDNSCKSNPCHNGG
VCHSRWDDFSCSCPALTSGKACEEVQWCGFSPCPHGAQCQPVLQGFECIANAVFNGQSGQ
ILFRSNGNITRELTNITFGFRTRDANVIILHAEKEPEFLNISIQDSRLFFQLQSGNSFYM
LSLTSLQSVNDGTWHEVTLSMTDPLSQTSRWQMEVDNETPFVTSTIATGSLNFLKDNTDI
YVGDRAIDNIKGLQGCLSTIEIGGIYLSYFENVHGFINKPQEEQFLKISTNSVVTGCLQL
NVCNSNPCLHGGNCEDIYSSYHCSCPLGWSGKHCELNIDECFSNPCIHGNCSDRVAAYHC
TCEPGYTGVNCEVDIDNCQSHQCANGATCISHTNGYSCLCFGNFTGKFCRQSRLPSTVCG
NEKTNLTCYNGGNCTEFQTELKCMCRPGFTGEWCEKDIDECASDPCVNGGLCQDLLNKFQ
CLCDVAFAGERCEVDLADDLISDIFTTIGSVTVALLLILLLAIVASVVTSNKRATQGTYS
PSRQEKEGSRVEMWNLMPPPAMERLI
NT seq 4221 nt NT seq  +upstreamnt  +downstreamnt
atggcacttaagaacattaactaccttctcatcttctacctcagtttctcactgcttatc
tacataaaaaattccttttgcaataaaaacaacaccaggtgcctctcaaattcttgccaa
aacaattctacatgcaaagatttttcaaaagacaatgattgttcttgttcagacacagcc
aataatttggacaaagactgtgacaacatgaaagacccttgcttctccaatccctgtcaa
ggaagtgccacttgtgtgaacaccccaggagaaaggagctttctgtgcaaatgtcctcct
gggtacagtgggacaatctgtgaaactaccattggttcctgtggcaagaactcctgccaa
catggaggtatttgccatcaggaccctatttatcctgtctgcatctgccctgctggatat
gctggaagattctgtgagatagatcacgatgagtgtgcttccagcccttgccaaaatggg
gccgtgtgccaggatggaattgatggttactcctgcttctgtgtcccaggatatcaaggc
agacactgcgacttggaagtggatgaatgtgcttcagatccctgcaagaacgaggctaca
tgcctcaatgaaataggaagatatacttgtatctgtccccacaattattctggtgtaaac
tgtgaattggaaattgacgaatgttggtcccagccttgtttaaatggtgcaacttgtcag
gatgctctgggggcctatttctgcgactgtgcccctggattcctgggggatcactgtgaa
ctcaacactgatgagtgtgccagtcaaccttgtctccatggagggctgtgtgtggatgga
gaaaacagatatagctgtaactgcacgggtagtggattcacagggacacactgtgagacc
ttgatgcctctttgttggtcaaaaccttgtcacaataatgctacatgtgaggacagtgtt
gacaattacacttgtcactgctggcctggatacacaggtgcccagtgtgagatcgacctc
aatgaatgcaatagtaacccctgccagtccaatggggaatgtgtggagctgtcctcagag
aaacaatatggacgcatcactggactgccttcttctttcagctaccatgaagcctcaggt
tatgtctgtatctgtcagcctggattcacaggaatccactgcgaagaagacgtcaatgaa
tgttcttcaaacccttgccaaaatggtggtacttgtgagaacttgcctgggaattatact
tgccattgcccatttgataacctttctagaactttttatggaggaagggactgttctgat
attctcctgggctgtacccatcagcaatgtctaaataatggaacatgcatccctcacttc
caagatggccagcatggattcagctgcctgtgtccatctggctacaccgggtccctgtgt
gaaatcgcaaccacactttcatttgagggcgatggcttcctgtgggtcaaaagtggctca
gtgacaaccaagggctcagtttgtaacatagccctcaggtttcagactgttcagccaatg
gctcttctacttttccgaagcaacagggatgtgtttgtgaagctggagctgctaagtggc
tacattcacttatcaattcaggtcaataatcagtcaaaggtgcttctgttcatttcccac
aacaccagcgatggagagtggcatttcgtggaggtaatatttgcagaggctgtgaccctt
accttaatcgacgactcctgtaaggagaaatgcatcgcgaaagctcctactccacttgaa
agtgatcaatcaatatgtgcttttcagaactcctttttgggtggtttaccagtgggaatg
accagcaatggtgttgctctgcttaacttctataatatgccatccacaccttcgtttgta
ggctgtctccaagacattaaaattgattggaatcacattaccctggagaacatctcgtct
ggctcatcattaaatgtcaaggcaggctgtgtgagaaaggattggtgtgaaagccaacct
tgtcaaagcagaggacgctgcatcaacttgtggctgagttaccagtgtgactgccacagg
ccctatgaaggccccaactgtctgagagagtatgtggcaggcagatttggccaggatgac
tccactggttatgtcatctttactcttgatgagagctatggagacaccatcagcctctcc
atgtttgtccgaacgcttcaaccatcaggcttacttctagctttggaaaacagcacttat
caatatatccgtgtctggctagagcgcggcagactagcaatgctgactccaaactctccc
aaattagtagtaaaatttgttcttaatgatggaaatgtccacttgatatctttgaaaatc
aagccatataaaattgaactgtatcagtcttcacaaaacctaggatttatttctgcttct
acgtggaaaatcgaaaagggagatgtcatctacattggtggcctacctgacaagcaagag
actgaacttaatggtggattcttcaaaggctgtatccaagatgtaagactaaacaaccaa
aatctggaattctttccaaatccaacaaacaatgcatctctcaatccagttcttgtcaat
gtaacccaaggctgtgctggagacaacagctgcaagtccaacccctgtcacaatggaggt
gtttgccattcccggtgggatgacttctcctgttcctgtcctgccctcacaagtgggaaa
gcctgtgaggaggttcagtggtgtggattcagcccgtgtcctcacggagcccagtgccag
ccggtgcttcaaggatttgaatgtattgcaaatgctgtttttaatggacaaagcggtcaa
atattattcagaagcaatgggaatattaccagagaactcaccaatatcacatttggtttc
agaacaagggatgcaaatgtaataatattgcatgcagaaaaagagcctgaatttcttaat
attagcattcaagattccagattattctttcaattgcaaagtggcaacagcttttatatg
ctaagtctgacaagtttgcagtcagtgaatgatggcacatggcacgaagtgaccctttcc
atgacagacccactgtcccagacctccaggtggcaaatggaagtggacaacgaaacacct
tttgtgaccagcacaattgctactggaagcctcaactttttgaaggataatacagatatt
tatgtgggagacagagctattgacaatataaagggcctgcaagggtgtctaagtacaata
gaaatcggaggcatttatctctcttactttgaaaatgttcatggtttcattaataaacct
caggaagagcaatttctcaaaatctctaccaattcagtggtcactggctgtttgcagtta
aatgtctgcaactccaacccctgtttgcatggaggaaactgtgaagacatctatagctct
tatcattgctcctgtcccttgggatggtcagggaaacactgtgaactcaacatcgatgaa
tgcttttcaaacccctgtatccatggcaactgctctgacagagttgcagcctaccactgc
acatgtgagcctggatacactggtgtgaactgtgaagtggatatagacaactgccagagt
caccagtgtgcaaatggagccacctgcattagtcatactaatggctattcttgcctctgt
tttggaaattttacaggaaaattttgcagacagagcagattaccctcaacagtctgtggg
aatgagaagacaaatctcacttgctacaatggaggcaactgcacagagttccagactgaa
ttaaaatgtatgtgccggccaggttttactggagaatggtgtgaaaaggacattgatgag
tgtgcctctgatccgtgtgtcaatggaggtctgtgccaggacttactcaacaaattccag
tgcctctgtgatgttgcctttgctggcgagcgctgcgaggtggacttggcagatgacttg
atctccgacattttcaccactattggctcagtgactgtcgccttgttactgatcctcttg
ctggccattgttgcttctgttgtcacctccaacaaaagggcaactcagggaacctacagc
cccagccgtcaggagaaggagggctcccgagtggaaatgtggaacttgatgccaccccct
gcaatggagagactgatttag

DBGET integrated database retrieval system