KEGG   Homo sapiens (human): 23529Help
Entry
23529             CDS       T01001                                 

Gene name
CLCF1, BSF-3, BSF3, CISS2, CLC, NNT-1, NNT1, NR6
Definition
(RefSeq) cardiotrophin like cytokine factor 1
  KO
K05421  B-cell stimulating factor 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04060  Cytokine-cytokine receptor interaction
Disease
H00935  Cold-induced sweating syndrome (CISS) and Crisponi syndrome (CRISPS)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    23529 (CLCF1)
Cytokines and growth factors [BR:hsa04052]
 Cytokines
  CSF and other factors
   23529 (CLCF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PRF CNTF
Motif
Other DBs
NCBI-GeneID: 23529
NCBI-ProteinID: NP_037378
OMIM: 607672
HGNC: 17412
Ensembl: ENSG00000175505
Vega: OTTHUMG00000167669
Pharos: Q9UBD9(Tbio)
UniProt: Q9UBD9
LinkDB All DBs
Position
11q13.2
AA seq 225 aa AA seqDB search
MDLRAGDSWGMLACLCTVLWHLPAVPALNRTGDPGPGPSIQKTYDLTRYLEHQLRSLAGT
YLNYLGPPFNEPDFNPPRLGAETLPRATVDLEVWRSLNDKLRLTQNYEAYSHLLCYLRGL
NRQAATAELRRSLAHFCTSLQGLLGSIAGVMAALGYPLPQPLPGTEPTWTPGPAHSDFLQ
KMDDFWLLKELQTWLWRSAKDFNRLKKKMQPPAAAVTLHLGAHGF
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggacctccgagcaggggactcgtgggggatgttagcgtgcctgtgcacggtgctctgg
cacctccctgcagtgccagctctcaatcgcacaggggacccagggcctggcccctccatc
cagaaaacctatgacctcacccgctacctggagcaccaactccgcagcttggctgggacc
tatctgaactacctgggcccccctttcaacgagccagacttcaaccctccccgcctgggg
gcagagactctgcccagggccactgttgacttggaggtgtggcgaagcctcaatgacaaa
ctgcggctgacccagaactacgaggcctacagccaccttctgtgttacttgcgtggcctc
aaccgtcaggctgccactgctgagctgcgccgcagcctggcccacttctgcaccagcctc
cagggcctgctgggcagcattgcgggcgtcatggcagctctgggctacccactgccccag
ccgctgcctgggactgaacccacttggactcctggccctgcccacagtgacttcctccag
aagatggacgacttctggctgctgaaggagctgcagacctggctgtggcgctcggccaag
gacttcaaccggctcaagaagaagatgcagcctccagcagctgcagtcaccctgcacctg
ggggctcatggcttctga

DBGET integrated database retrieval system