KEGG   Homo sapiens (human): 2354Help
Entry
2354              CDS       T01001                                 

Gene name
FOSB, AP-1, G0S3, GOS3, GOSB
Definition
(RefSeq) FosB proto-oncogene, AP-1 transcription factor subunit
  KO
K09029  protein FosB
Organism
hsa  Homo sapiens (human)
Pathway
hsa04380  Osteoclast differentiation
hsa04657  IL-17 signaling pathway
hsa05030  Cocaine addiction
hsa05031  Amphetamine addiction
hsa05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    2354 (FOSB)
  09158 Development
   04380 Osteoclast differentiation
    2354 (FOSB)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    2354 (FOSB)
   05031 Amphetamine addiction
    2354 (FOSB)
   05034 Alcoholism
    2354 (FOSB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    2354 (FOSB)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Fos
    2354 (FOSB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DivIC DUF4407 DUF3450 DUF5082
Motif
Other DBs
NCBI-GeneID: 2354
NCBI-ProteinID: NP_006723
OMIM: 164772
HGNC: 3797
Ensembl: ENSG00000125740
Vega: OTTHUMG00000182122
Pharos: P53539(Tbio)
UniProt: P53539 A0A024R0P6
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 338 aa AA seqDB search
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEMPGSFVPTVTA
ITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMPGTSYSTPGMSGYSSGGASGS
GGPSTSGTTSGPGPARPARARPRRPREETLTPEEEEKRRVRRERNKLAAAKCRNRRRELT
DRLQAETDQLEEEKAELESEIAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRD
LPGSAPAKEDGFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaggctttccccggagactacgactccggctcccggtgcagctcctcaccctct
gccgagtctcaatatctgtcttcggtggactccttcggcagtccacccaccgccgccgcc
tcccaggagtgcgccggtctcggggaaatgcccggttccttcgtgcccacggtcaccgcg
atcacaaccagccaggacctccagtggcttgtgcaacccaccctcatctcttccatggcc
cagtcccaggggcagccactggcctcccagcccccggtcgtcgacccctacgacatgccg
ggaaccagctactccacaccaggcatgagtggctacagcagtggcggagcgagtggcagt
ggtgggccttccaccagcggaactaccagtgggcctgggcctgcccgcccagcccgagcc
cggcctaggagaccccgagaggagacgctcaccccagaggaagaggagaagcgaagggtg
cgccgggaacgaaataaactagcagcagctaaatgcaggaaccggcggagggagctgacc
gaccgactccaggcggagacagatcagttggaggaagaaaaagcagagctggagtcggag
atcgccgagctccaaaaggagaaggaacgtctggagtttgtgctggtggcccacaaaccg
ggctgcaagatcccctacgaagaggggcccgggccgggcccgctggcggaggtgagagat
ttgccgggctcagcaccggctaaggaagatggcttcagctggctgctgccgcccccgcca
ccaccgcccctgcccttccagaccagccaagacgcaccccccaacctgacggcttctctc
tttacacacagtgaagttcaagtcctcggcgaccccttccccgttgttaacccttcgtac
acttcttcgtttgtcctcacctgcccggaggtctccgcgttcgccggcgcccaacgcacc
agcggcagtgaccagccttccgatcccctgaactcgccctccctcctcgctctgtga

DBGET integrated database retrieval system