KEGG   Homo sapiens (human): 23553
Entry
23553             CDS       T01001                                 

Gene name
HYAL4, CSHY, HYAL-4
Definition
(RefSeq) hyaluronidase 4
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    23553 (HYAL4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    23553 (HYAL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    23553 (HYAL4)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    23553 (HYAL4)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    23553 (HYAL4)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     23553 (HYAL4)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   23553 (HYAL4)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   23553 (HYAL4)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  23553 (HYAL4)
SSDB
Motif
Pfam: Glyco_hydro_56 EGF
Other DBs
NCBI-GeneID: 23553
NCBI-ProteinID: NP_036401
OMIM: 604510
HGNC: 5323
Ensembl: ENSG00000106302
Vega: OTTHUMG00000157349
Pharos: Q2M3T9(Tbio)
UniProt: Q2M3T9
LinkDB
Position
7q31.32
AA seq 481 aa
MKVLSEGQLKLCVVQPVHLTSWLLIFFILKSISCLKPARLPIYQRKPFIAAWNAPTDQCL
IKYNLRLNLKMFPVIGSPLAKARGQNVTIFYVNRLGYYPWYTSQGVPINGGLPQNISLQV
HLEKADQDINYYIPAEDFSGLAVIDWEYWRPQWARNWNSKDVYRQKSRKLISDMGKNVSA
TDIEYLAKVTFEESAKAFMKETIKLGIKSRPKGLWGYYLYPDCHNYNVYAPNYSGSCPED
EVLRNNELSWLWNSSAALYPSIGVWKSLGDSENILRFSKFRVHESMRISTMTSHDYALPV
FVYTRLGYRDEPLFFLSKQDLVSTIGESAALGAAGIVIWGDMNLTASKANCTKVKQFVSS
DLGSYIANVTRAAEVCSLHLCRNNGRCIRKMWNAPSYLHLNPASYHIEASEDGEFTVKGK
ASDTDLAVMADTFSCHCYQGYEGADCREIKTADGCSGVSPSPGSLMTLCLLLLASYRSIQ
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atgaaagtattatctgaaggacagttaaagctttgtgttgttcaaccagtacatctcact
tcatggctccttatattttttattctaaagtctatctcttgtctaaaacctgctcgactt
ccaatttatcaaaggaaaccttttatagctgcttggaatgctccaacagatcagtgtttg
ataaaatataatttaagactaaatttgaaaatgtttcctgtgattggaagcccactggcc
aaggccagggggcaaaatgtcactatattttatgtcaacagattgggatactatccgtgg
tatacatcacaaggggtccccattaatggaggtctcccacagaacataagtttacaagta
catctggaaaaagctgaccaagatattaattattacatccctgctgaagatttcagtgga
cttgctgttatagattgggaatattggcgaccacagtgggcccggaactggaactcaaaa
gatgtttacagacagaagtcaagaaagcttatttccgatatgggaaagaatgtatcagct
accgatattgaatatttagccaaagtgacctttgaagaaagtgcaaaagctttcatgaag
gaaaccatcaaattgggaattaagagccgacccaaaggcctttggggttattatttatat
cctgattgccacaattataacgtttatgccccaaactactctgggtcatgcccagaagac
gaagtcttgaggaacaatgagctctcttggctctggaacagcagtgctgctttatatcct
tctatcggtgtctggaaatcccttggagacagtgaaaacattttgcgcttctccaaattt
cgggtgcatgaatccatgaggatctccaccatgacatctcatgattatgctctgcctgta
tttgtctacacaaggctagggtacagagatgaacctttatttttcctttctaagcaagat
ctagtcagcaccataggagaaagtgctgccttgggagctgcaggcattgttatttgggga
gacatgaatttaactgcatccaaggccaactgtacaaaggtgaagcagtttgtgagttct
gatttagggagctacatagccaatgtgaccagagctgctgaggtatgcagccttcacctc
tgcaggaacaatggcaggtgcataaggaagatgtggaacgcgcccagttaccttcacttg
aaccctgcaagttaccacatagaggcctctgaggacggggagtttactgtgaaaggaaaa
gcatctgatacagacctggcagtgatggcagatacattttcctgtcattgttatcaggga
tatgaaggagctgattgcagagaaataaagacggctgatggctgctctggggtttcccct
tctcctggttcactaatgacactttgtctactgcttttagcaagttatcgaagcattcag
ttgtga

KEGG   Homo sapiens (human): 3373
Entry
3373              CDS       T01001                                 

Gene name
HYAL1, HYAL-1, LUCA1, MPS9, NAT6
Definition
(RefSeq) hyaluronidase 1
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
N00611  HYAL1 deficiency in dermatan sulfate degradation
Disease
H00133  Mucopolysaccharidosis type IX
H00421  Mucopolysaccharidosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    3373 (HYAL1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    3373 (HYAL1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    3373 (HYAL1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    3373 (HYAL1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    3373 (HYAL1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     3373 (HYAL1)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   3373 (HYAL1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   3373 (HYAL1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  3373 (HYAL1)
SSDB
Motif
Pfam: Glyco_hydro_56
Other DBs
NCBI-GeneID: 3373
NCBI-ProteinID: NP_149349
OMIM: 607071
HGNC: 5320
Ensembl: ENSG00000114378
Vega: OTTHUMG00000156941
Pharos: Q12794(Tbio)
UniProt: Q12794 A0A024R2X3
LinkDB
Structure
PDB: 
2PE4

Position
3p21.31
AA seq 435 aa
MAAHLLPICALFLTLLDMAQGFRGPLLPNRPFTTVWNANTQWCLERHGVDVDVSVFDVVA
NPGQTFRGPDMTIFYSSQLGTYPYYTPTGEPVFGGLPQNASLIAHLARTFQDILAAIPAP
DFSGLAVIDWEAWRPRWAFNWDTKDIYRQRSRALVQAQHPDWPAPQVEAVAQDQFQGAAR
AWMAGTLQLGRALRPRGLWGFYGFPDCYNYDFLSPNYTGQCPSGIRAQNDQLGWLWGQSR
ALYPSIYMPAVLEGTGKSQMYVQHRVAEAFRVAVAAGDPNLPVLPYVQIFYDTTNHFLPL
DELEHSLGESAAQGAAGVVLWVSWENTRTKESCQAIKEYMDTTLGPFILNVTSGALLCSQ
ALCSGHGRCVRRTSHPKALLLLNPASFSIQLTPGGGPLSLRGALSLEDQAQMAVEFKCRC
YPGWQAPWCERKSMW
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcagcccacctgcttcccatctgcgccctcttcctgaccttactcgatatggcccaa
ggctttaggggccccttgctacccaaccggcccttcaccaccgtctggaatgcaaacacc
cagtggtgcctggagaggcacggtgtggacgtggatgtcagtgtcttcgatgtggtagcc
aacccagggcagaccttccgcggccctgacatgacaattttctatagctcccagctgggc
acctacccctactacacgcccactggggagcctgtgtttggtggtctgccccagaatgcc
agcctgattgcccacctggcccgcacattccaggacatcctggctgccatacctgctcct
gacttctcagggctggcagtcatcgactgggaggcatggcgcccacgctgggccttcaac
tgggacaccaaggacatttaccggcagcgctcacgggcactggtacaggcacagcaccct
gattggccagctcctcaggtggaggcagtagcccaggaccagttccagggagctgcacgg
gcctggatggcaggcaccctccagctggggcgggcactgcgtcctcgcggcctctggggc
ttctatggcttccctgactgctacaactatgactttctaagccccaactacaccggccag
tgcccatcaggcatccgtgcccaaaatgaccagctagggtggctgtggggccagagccgt
gccctctatcccagcatctacatgcccgcagtgctggagggcacagggaagtcacagatg
tatgtgcaacaccgtgtggccgaggcattccgtgtggctgtggctgctggtgaccccaat
ctgccggtgctgccctatgtccagatcttctatgacacgacaaaccactttctgcccctg
gatgagctggagcacagcctgggggagagtgcggcccagggggcagctggagtggtgctc
tgggtgagctgggaaaatacaagaaccaaggaatcatgtcaggccatcaaggagtatatg
gacactacactggggcccttcatcctgaacgtgaccagtggggcccttctctgcagtcaa
gccctgtgctccggccatggccgctgtgtccgccgcaccagccaccccaaagccctcctc
ctccttaaccctgccagtttctccatccagctcacgcctggtggtgggcccctgagcctg
cggggtgccctctcacttgaagatcaggcacagatggctgtggagttcaaatgtcgatgc
taccctggctggcaggcaccgtggtgtgagcggaagagcatgtggtga

KEGG   Homo sapiens (human): 6677
Entry
6677              CDS       T01001                                 

Gene name
SPAM1, HEL-S-96n, HYA1, HYAL1, HYAL3, HYAL5, PH-20, PH20, SPAG15
Definition
(RefSeq) sperm adhesion molecule 1
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    6677 (SPAM1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    6677 (SPAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    6677 (SPAM1)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    6677 (SPAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    6677 (SPAM1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     6677 (SPAM1)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   6677 (SPAM1)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   6677 (SPAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  6677 (SPAM1)
SSDB
Motif
Pfam: Glyco_hydro_56 DUF2180
Other DBs
NCBI-GeneID: 6677
NCBI-ProteinID: NP_001167515
OMIM: 600930
HGNC: 11217
Ensembl: ENSG00000106304
Vega: OTTHUMG00000157284
Pharos: P38567(Tbio)
UniProt: P38567 Q5D1J4
LinkDB
Position
7q31.32
AA seq 509 aa
MGVLKFKHIFFRSFVKSSGVSQIVFTFLLIPCCLTLNFRAPPVIPNVPFLWAWNAPSEFC
LGKFDEPLDMSLFSFIGSPRINATGQGVTIFYVDRLGYYPYIDSITGVTVNGGIPQKISL
QDHLDKAKKDITFYMPVDNLGMAVIDWEEWRPTWARNWKPKDVYKNRSIELVQQQNVQLS
LTEATEKAKQEFEKAGKDFLVETIKLGKLLRPNHLWGYYLFPDCYNHHYKKPGYNGSCFN
VEIKRNDDLSWLWNESTALYPSIYLNTQQSPVAATLYVRNRVREAIRVSKIPDAKSPLPV
FAYTRIVFTDQVLKFLSQDELVYTFGETVALGASGIVIWGTLSIMRSMKSCLLLDNYMET
ILNPYIINVTLAAKMCSQVLCQEQGVCIRKNWNSSDYLHLNPDNFAIQLEKGGKFTVRGK
PTLEDLEQFSEKFYCSCYSTLSCKEKADVKDTDAVDVCIADGVCIDAFLKPPMETEEPQI
FYNASPSTLSATMFIVSILFLIISSVASL
NT seq 1530 nt   +upstreamnt  +downstreamnt
atgggagtgctaaaattcaagcacatctttttcagaagctttgttaaatcaagtggagta
tcccagatagttttcaccttccttctgattccatgttgcttgactctgaatttcagagca
cctcctgttattccaaatgtgcctttcctctgggcctggaatgccccaagtgaattttgt
cttggaaaatttgatgagccactagatatgagcctcttctctttcataggaagcccccga
ataaacgccaccgggcaaggtgttacaatattttatgttgatagacttggctactatcct
tacatagattcaatcacaggagtaactgtgaatggaggaatcccccagaagatttcctta
caagaccatctggacaaagctaagaaagacattacattttatatgccagtagacaatttg
ggaatggctgttattgactgggaagaatggagacccacttgggcaagaaactggaaacct
aaagatgtttacaagaataggtctattgaattggttcagcaacaaaatgtacaacttagt
ctcacagaggccactgagaaagcaaaacaagaatttgaaaaggcagggaaggatttcctg
gtagagactataaaattgggaaaattacttcggccaaatcacttgtggggttattatctt
tttccggattgttacaaccatcactataagaaacccggttacaatggaagttgcttcaat
gtagaaataaaaagaaatgatgatctcagctggttgtggaatgaaagcactgctctttac
ccatccatttatttgaacactcagcagtctcctgtagctgctacactctatgtgcgcaat
cgagttcgggaagccatcagagtttccaaaatacctgatgcaaaaagtccacttccggtt
tttgcatatacccgcatagtttttactgatcaagttttgaaattcctttctcaagatgaa
cttgtgtatacatttggcgaaactgttgctctgggtgcttctggaattgtaatatgggga
accctcagtataatgcgaagtatgaaatcttgcttgctcctagacaattacatggagact
atactgaatccttacataatcaacgtcacactagcagccaaaatgtgtagccaagtgctt
tgccaggagcaaggagtgtgtataaggaaaaactggaattcaagtgactatcttcacctc
aacccagataattttgctattcaacttgagaaaggtggaaagttcacagtacgtggaaaa
ccgacacttgaagacctggagcaattttctgaaaaattttattgcagctgttatagcacc
ttgagttgtaaggagaaagctgatgtaaaagacactgatgctgttgatgtgtgtattgct
gatggtgtctgtatagatgcttttctaaaacctcccatggagacagaagaacctcaaatt
ttctacaatgcttcaccctccacactatctgccacaatgttcattgttagtattttgttt
cttatcatttcttctgtagcgagtttgtaa

KEGG   Homo sapiens (human): 8372
Entry
8372              CDS       T01001                                 

Gene name
HYAL3, HYAL-3, LUCA-3, LUCA3
Definition
(RefSeq) hyaluronidase 3
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    8372 (HYAL3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8372 (HYAL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    8372 (HYAL3)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    8372 (HYAL3)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    8372 (HYAL3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     8372 (HYAL3)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   8372 (HYAL3)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   8372 (HYAL3)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  8372 (HYAL3)
SSDB
Motif
Pfam: Glyco_hydro_56 EGF_2 Peptidase_M29 EGF
Other DBs
NCBI-GeneID: 8372
NCBI-ProteinID: NP_001186958
OMIM: 604038
HGNC: 5322
Ensembl: ENSG00000186792
Vega: OTTHUMG00000156936
Pharos: O43820(Tbio)
UniProt: O43820
LinkDB
Position
3p21.31
AA seq 417 aa
MTTQLGPALVLGVALCLGCGQPLPQVPERPFSVLWNVPSAHCEARFGVHLPLNALGIIAN
RGQHFHGQNMTIFYKNQLGLYPYFGPRGTAHNGGIPQALPLDRHLALAAYQIHHSLRPGF
AGPAVLDWEEWCPLWAGNWGRRRAYQAASWAWAQQVFPDLDPQEQLYKAYTGFEQAARAL
MEDTLRVAQALRPHGLWGFYHYPACGNGWHSMASNYTGRCHAATLARNTQLHWLWAASSA
LFPSIYLPPRLPPAHHQAFVRHRLEEAFRVALVGHRHPLPVLAYVRLTHRRSGRFLSQDD
LVQSIGVSAALGAAGVVLWGDLSLSSSEEECWHLHDYLVDTLGPYVINVTRAAMACSHQR
CHGHGRCARRDPGQMEAFLHLWPDGSLGDWKSFSCHCYWGWAGPTCQEPRPGPKEAV
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgaccacgcaactgggcccagccctggtgctgggggtggccctgtgcctgggttgtggc
cagcccctaccacaggtccctgaacgccccttctctgtgctgtggaatgtaccctcagca
cactgtgaggcccgctttggtgtgcacctgccactcaatgctctgggcatcatagccaac
cgtggccagcattttcacggtcagaacatgaccattttctacaagaaccaactcggcctc
tatccctactttggacccaggggcacagctcacaatgggggcatcccccaggctttgccc
cttgaccgccacctggcactggctgcctaccagatccaccacagcctgagacctggcttt
gctggcccagcagtgctggattgggaggagtggtgtccactctgggctgggaactggggc
cgccgccgagcttatcaggcagcctcttgggcttgggcacagcaggtattccctgacctg
gaccctcaggagcagctctacaaggcctatactggctttgagcaggcggcccgtgcactg
atggaggatacgctgcgggtggcccaggcactacggccccatggactctggggcttctat
cactacccagcctgtggcaatggctggcatagtatggcttccaactataccggccgctgc
catgcagccacccttgcccgcaacactcaactgcattggctctgggccgcctccagtgcc
ctcttccccagcatctacctcccacccaggctgccacctgcccaccaccaggcctttgtc
cgacatcgcctggaggaggccttccgtgtggcccttgttgggcaccgacatcccctgcct
gtcctggcctatgtccgcctcacacaccggagatctgggaggttcctgtcccaggatgac
cttgtgcagtccattggtgtgagtgcagcactaggggcagccggcgtggtgctctggggg
gacctgagcctctccagctctgaggaggagtgctggcatctccatgactacctggtggac
accttgggcccctatgtgatcaatgtgaccagggcagcgatggcctgcagtcaccagcgg
tgccatggccacgggcgctgtgcccggcgagatccaggacagatggaagcctttctacac
ctgtggccagacggcagccttggagattggaagtccttcagctgccactgttactggggc
tgggctggccccacctgccaggagcccaggcctgggcctaaagaagcagtataa

KEGG   Homo sapiens (human): 8692
Entry
8692              CDS       T01001                                 

Gene name
HYAL2, LUCA2
Definition
(RefSeq) hyaluronidase 2
  KO
K01197  hyaluronoglucosaminidase [EC:3.2.1.35]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00531  Glycosaminoglycan degradation
hsa01100  Metabolic pathways
hsa04142  Lysosome
Module
hsa_M00076  Dermatan sulfate degradation
hsa_M00077  Chondroitin sulfate degradation
Network
nt06012  Glycosaminoglycan degradation
  Element
N00610  Dermatan sulfate degradation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    8692 (HYAL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    8692 (HYAL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02042 Bacterial toxins [BR:hsa02042]
    8692 (HYAL2)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    8692 (HYAL2)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
    8692 (HYAL2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.35  hyaluronoglucosaminidase
     8692 (HYAL2)
Bacterial toxins [BR:hsa02042]
 Toxins that damage the extracellular matrix
  Hyaluronidases/Collagenases
   8692 (HYAL2)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Heparin
  Enzymes
   8692 (HYAL2)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:hsa00537]
 Enzymes
  8692 (HYAL2)
SSDB
Motif
Pfam: Glyco_hydro_56 EGF
Other DBs
NCBI-GeneID: 8692
NCBI-ProteinID: NP_003764
OMIM: 603551
HGNC: 5321
Ensembl: ENSG00000068001
Vega: OTTHUMG00000156876
Pharos: Q12891(Tbio)
UniProt: Q12891
LinkDB
Position
3p21.31
AA seq 473 aa
MRAGPGPTVTLALVLAVSWAMELKPTAPPIFTGRPFVVAWDVPTQDCGPRLKVPLDLNAF
DVQASPNEGFVNQNITIFYRDRLGLYPRFDSAGRSVHGGVPQNVSLWAHRKMLQKRVEHY
IRTQESAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASRHPDWPPDRIVKQAQYEFE
FAAQQFMLETLRYVKAVRPRHLWGFYLFPDCYNHDYVQNWESYTGRCPDVEVARNDQLAW
LWAESTALFPSVYLDETLASSRHGRNFVSFRVQEALRVARTHHANHALPVYVFTRPTYSR
RLTGLSEMDLISTIGESAALGAAGVILWGDAGYTTSTETCQYLKDYLTRLLVPYVVNVSW
ATQYCSRAQCHGHGRCVRRNPSASTFLHLSTNSFRLVPGHAPGEPQLRPVGELSWADIDH
LQTHFRCQCYLGWSGEQCQWDHRQAAGGASEAWAGSHLTSLLALAALAFTWTL
NT seq 1422 nt   +upstreamnt  +downstreamnt
atgcgggcaggcccaggccccaccgttacattggccctggtgctggcggtgtcatgggcc
atggagctcaagcccacagcaccacccatcttcactggccggccctttgtggtagcgtgg
gacgtgcccacacaggactgtggcccacgcctcaaggtgccactggacctgaatgccttt
gatgtgcaggcctcacctaatgagggttttgtgaaccagaatattaccatcttctaccgc
gaccgtctaggcctgtatccacgcttcgattctgccggaaggtctgtgcatggtggtgtg
ccacagaatgtcagcctttgggcacaccggaagatgctgcagaaacgtgtggagcactac
attcggacacaggagtctgcggggctggcggtcatcgactgggaggactggcgacctgtg
tgggtgcgcaactggcaggacaaagatgtgtatcgccggttatcacgccagctagtggcc
agtcgtcaccctgactggcctccagaccgcatagtcaaacaggcacaatatgagtttgag
ttcgcagcacagcagttcatgctggagacactgcgttatgtcaaggcagtgcggccccgg
cacctctggggcttctacctctttcctgactgctacaatcatgattatgtgcagaactgg
gagagctacacaggccgctgccctgatgttgaggtggcccgcaatgaccagctggcctgg
ctgtgggctgagagcacggccctcttcccgtctgtctacctggacgagacacttgcttcc
tcccgccatggccgcaactttgtgagcttccgtgttcaggaggcccttcgtgtggctcgc
acccaccatgccaaccatgcactcccagtctacgtcttcacacgacccacctacagccgc
aggctcacggggcttagtgagatggacctcatctctaccattggcgagagtgcggccctg
ggcgcagctggtgtcatcctctggggtgacgcggggtacaccacaagcacggagacctgc
cagtacctcaaagattacctgacacggctgctggtcccctacgtggtcaatgtgtcctgg
gccacccaatattgcagccgggcccagtgccatggccatgggcgctgtgtgcgccgcaac
cccagtgccagtaccttcctgcatctcagcaccaacagtttccgcctagtgcctggccat
gcacctggtgaaccccagctgcgacctgtgggggagctcagttgggccgacattgaccac
ctgcagacacacttccgctgccagtgctacttgggctggagtggtgagcaatgccagtgg
gaccataggcaggcagctggaggtgccagcgaggcctgggctgggtcccacctcaccagt
ctgctggctctggcagccctggcctttacctggaccttgtag

DBGET integrated database retrieval system