KEGG   Homo sapiens (human): 23594Help
Entry
23594             CDS       T01001                                 

Gene name
ORC6, ORC6L
Definition
(RefSeq) origin recognition complex subunit 6
  KO
K02608  origin recognition complex subunit 6
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    23594 (ORC6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    23594 (ORC6)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    23594 (ORC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ORC6
Motif
Other DBs
NCBI-GeneID: 23594
NCBI-ProteinID: NP_055136
OMIM: 607213
HGNC: 17151
Ensembl: ENSG00000091651
Vega: OTTHUMG00000132539
Pharos: Q9Y5N6(Tbio)
UniProt: Q9Y5N6 A0A024R6R3
LinkDB All DBs
Structure
PDB: 

Position
16q11.2
AA seq 252 aa AA seqDB search
MGSELIGRLAPRLGLAEPDMLRKAEEYLRLSRVKCVGLSARTTETSSAVMCLDLAASWMK
CPLDRAYLIKLSGLNKETYQSCLKSFECLLGLNSNIGIRDLAVQFSCIEAVNMASKILKS
YESSLPQTQQVDLDLSRPLFTSAALLSACKILKLKVDKNKMVATSGVKKAIFDRLCKQLE
KIGQQVDREPGDVATPPRKRKKIVVEAPAKEMEKVEEMPHKPQKDEDLTQDYEEWKRKIL
ENAASAQKATAE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggggtcggagctgatcgggcgcctagccccgcgcctgggcctcgccgagcccgacatg
ctgaggaaagcagaggagtacttgcgcctgtcccgggtgaagtgtgtcggcctctccgca
cgcaccacggagaccagcagtgcagtcatgtgcctggaccttgcagcttcctggatgaag
tgccccttggacagggcttatttaattaaactttctggtttgaacaaggagacatatcag
agctgtcttaaatcttttgagtgtttactgggcctgaattcaaatattggaataagagac
ctagctgtacagtttagctgtatagaagcagtgaacatggcttcaaagatactaaaaagc
tatgagtccagtcttccccagacacagcaagtggatcttgacttatccaggccacttttc
acttctgctgcactgctttcagcatgcaagattctaaagctgaaagtggataaaaacaaa
atggtagccacatccggtgtaaaaaaagctatatttgatcgactgtgtaaacaactagag
aagattggacagcaggtcgacagagaacctggagatgtagctactccaccacggaagaga
aagaagatagtggttgaagccccagcaaaggaaatggagaaggtagaggagatgccacat
aaaccacagaaagatgaagatctgacacaggattatgaagaatggaaaagaaaaattttg
gaaaatgctgccagtgctcaaaaggctacagcagagtga

DBGET integrated database retrieval system