KEGG   Homo sapiens (human): 23643Help
Entry
23643             CDS       T01001                                 

Gene name
LY96, ESOP-1, MD-2, MD2, ly-96
Definition
(RefSeq) lymphocyte antigen 96
  KO
K05400  lymphocyte antigen 96
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04620  Toll-like receptor signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05133  Pertussis
hsa05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    23643 (LY96)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    23643 (LY96)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    23643 (LY96)
   05133 Pertussis
    23643 (LY96)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    23643 (LY96)
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 23643
NCBI-ProteinID: NP_056179
OMIM: 605243
HGNC: 17156
Ensembl: ENSG00000154589
Vega: OTTHUMG00000164504
Pharos: Q9Y6Y9(Tbio)
UniProt: Q9Y6Y9
LinkDB All DBs
Structure
PDB: 

Position
8q21.11
AA seq 160 aa AA seqDB search
MLPFLFFSTLFSSIFTEAQKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGL
LHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFS
FKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgttaccatttctgtttttttccaccctgttttcttccatatttactgaagctcagaag
cagtattgggtctgcaactcatccgatgcaagtatttcatacacctactgtgataaaatg
caatacccaatttcaattaatgttaacccctgtatagaattgaaaggatccaaaggatta
ttgcacattttctacattccaaggagagatttaaagcaattatatttcaatctctatata
actgtcaacaccatgaatcttccaaagcgcaaagaagttatttgccgaggatctgatgac
gattactctttttgcagagctctgaagggagagactgtgaatacaacaatatcattctcc
ttcaagggaataaaattttctaagggaaaatacaaatgtgttgttgaagctatttctggg
agcccagaagaaatgctcttttgcttggagtttgtcatcctacaccaacctaattcaaat
tag

DBGET integrated database retrieval system