KEGG   Homo sapiens (human): 23649Help
Entry
23649             CDS       T01001                                 

Gene name
POLA2
Definition
(RefSeq) DNA polymerase alpha 2, accessory subunit
  KO
K02321  DNA polymerase alpha subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa03030  DNA replication
Module
hsa_M00261  DNA polymerase alpha / primase complex
Drug target
Clofarabine: D03546
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    23649 (POLA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    23649 (POLA2)
DNA replication proteins [BR:hsa03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   DNA polymerase alpha / primase complex
    23649 (POLA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_pol_E_B Pol_alpha_B_N
Motif
Other DBs
NCBI-GeneID: 23649
NCBI-ProteinID: NP_002680
HGNC: 30073
Ensembl: ENSG00000014138 ENSG00000285816
Vega: OTTHUMG00000165951
Pharos: Q14181(Tbio)
UniProt: Q14181
LinkDB All DBs
Structure
PDB: 

Position
11q13.1
AA seq 598 aa AA seqDB search
MSASAQQLAEELQIFGLDCEEALIEKLVELCVQYGQNEEGMVGELIAFCTSTHKVGLTSE
ILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEEEEEILLNSYTTPSKGS
QKRAISTPETPLTKRSVSTRSPHQLLSPSSFSPSATPSQKYNSRSNRGEVVTSFGLAQGV
SWSGRGGAGNISLKVLGCPEALTGSYKSMFQKLPDIREVLTCKIEELGSELKEHYKIEAF
TPLLAPAQEPVTLLGQIGCDSNGKLNNKSVILEGDREHSSGAQIPVDLSELKEYSLFPGQ
VVIMEGINTTGRKLVATKLYEGVPLPFYQPTEEDADFEQSMVLVACGPYTTSDSITYDPL
LDLIAVINHDRPDVCILFGPFLDAKHEQVENCLLTSPFEDIFKQCLRTIIEGTRSSGSHL
VFVPSLRDVHHEPVYPQPPFSYSDLSREDKKQVQFVSEPCSLSINGVIFGLTSTDLLFHL
GAEEISSSSGTSDRFSRILKHILTQRSYYPLYPPQEDMAIDYESFYVYAQLPVTPDVLII
PSELRYFVKDVLGCVCVNPGRLTKGQVGGTFARLYLRRPAADGAERQSPCIAVQVVRI
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcatccgcccagcagctggcggaggagctgcagatcttcggcctagactgcgag
gaggctctaattgagaaattggtagagctttgtgttcagtatggacagaatgaggaggga
atggtaggcgagcttatagccttctgcaccagcacacataaagttggccttacctcagag
atcctgaactcttttgagcatgagtttctgagcaaaagattatcgaaagccaggcatagt
acctgcaaggacagtggccatgcaggagctagagacattgtttccattcaagagctaatt
gaagtggaagaagaagaggaaatcctcttgaactcttacaccacaccttcaaagggttct
cagaagcgagctatctctaccccagaaacccccctaacaaaaaggagtgtgtcaactcgt
agcccccatcagctactctcaccgtcaagtttctctccaagtgctactccctcccagaaa
tacaactcacgaagtaaccgaggagaagtggttacctccttcggcttagcacagggagta
tcttggtctgggagaggaggagctggaaacatcagcctgaaggtcttgggatgtccagag
gcactaactgggagctacaaatccatgtttcagaagctcccagacattcgagaagttctg
acctgtaagatagaagaacttggcagcgaactcaaggaacattacaagattgaagctttc
actcctttgctagccccagcacaggagcctgtcactctgctgggccagattggctgtgat
agcaacgggaagctgaacaacaagtcagtgattctcgagggagaccgggaacattcctcg
ggtgctcaaattccagtggatttatctgagcttaaggaatattctctgtttcctggacag
gttgtaattatggaaggaatcaacaccactggtaggaaacttgttgccaccaaactctac
gagggtgtgccacttccattttatcagcccactgaagaggatgcagactttgagcaaagc
atggtcctggttgcctgtggaccatacaccacatctgacagcatcacgtatgaccccctg
cttgacctgattgctgtcatcaaccatgaccggccagatgtctgcatcctgtttggccct
ttcctggatgctaagcatgaacaggtggagaattgtctactgacaagtccatttgaagac
attttcaagcagtgtctacgaacaattattgaaggcacaagaagctccggctcccacctt
gtctttgtcccgtcattgagagatgtgcaccatgagcctgtgtacccccagccgcctttc
agctactccgatctgtctcgagaggacaaaaagcaagtacagtttgtgtccgagccctgc
agcctctccataaacggagtgatcttcggcttgacatccacagatctgcttttccacctg
ggggccgaggagatcagtagttcttccggaacttcagacagattcagccgaatactcaag
cacatcttgacccagaggagctactacccactctacccgccccaagaagacatggccatt
gactatgagtcgttctatgtttacgcacagctgcctgtcaccccagatgtcctcatcatc
ccgtcagagctgaggtacttcgtgaaggatgtcctcggctgtgtctgtgtgaaccctggg
cgccttaccaaagggcaggtgggaggcaccttcgcccgactctaccttaggaggccggca
gcggacggggcagagaggcagagcccatgcattgctgtgcaggtcgtcaggatctga

DBGET integrated database retrieval system