KEGG   Homo sapiens (human): 23654Help
Entry
23654             CDS       T01001                                 

Gene name
PLXNB2, MM1, Nbla00445, PLEXB2, dJ402G11.3
Definition
(RefSeq) plexin B2
  KO
K06821  plexin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    23654 (PLXNB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_plexin PSI Peptidase_S64 RasGAP ARL2_Bind_BART OPA3 DUF3149
Motif
Other DBs
NCBI-GeneID: 23654
NCBI-ProteinID: NP_036533
OMIM: 604293
HGNC: 9104
Ensembl: ENSG00000196576
Vega: OTTHUMG00000150219
Pharos: O15031(Tbio)
UniProt: O15031
LinkDB All DBs
Structure
PDB: 

Position
22q13.33
AA seq 1838 aa AA seqDB search
MALQLWALTLLGLLGAGASLRPRKLDFFRSEKELNHLAVDEASGVVYLGAVNALYQLDAK
LQLEQQVATGPALDNKKCTPPIEASQCHEAEMTDNVNQLLLLDPPRKRLVECGSLFKGIC
ALRALSNISLRLFYEDGSGEKSFVASNDEGVATVGLVSSTGPGGDRVLFVGKGNGPHDNG
IIVSTRLLDRTDSREAFEAYTDHATYKAGYLSTNTQQFVAAFEDGPYVFFVFNQQDKHPA
RNRTLLARMCREDPNYYSYLEMDLQCRDPDIHAAAFGTCLAASVAAPGSGRVLYAVFSRD
SRSSGGPGAGLCLFPLDKVHAKMEANRNACYTGTREARDIFYKPFHGDIQCGGHAPGSSK
SFPCGSEHLPYPLGSRDGLRGTAVLQRGGLNLTAVTVAAENNHTVAFLGTSDGRILKVYL
TPDGTSSEYDSILVEINKRVKRDLVLSGDLGSLYAMTQDKVFRLPVQECLSYPTCTQCRD
SQDPYCGWCVVEGRCTRKAECPRAEEASHWLWSRSKSCVAVTSAQPQNMSRRAQGEVQLT
VSPLPALSEEDELLCLFGESPPHPARVEGEAVICNSPSSIPVTPPGQDHVAVTIQLLLRR
GNIFLTSYQYPFYDCRQAMSLEENLPCISCVSNRWTCQWDLRYHECREASPNPEDGIVRA
HMEDSCPQFLGPSPLVIPMNHETDVNFQGKNLDTVKGSSLHVGSDLLKFMEPVTMQESGT
FAFRTPKLSHDANETLPLHLYVKSYGKNIDSKLHVTLYNCSFGRSDCSLCRAANPDYRCA
WCGGQSRCVYEALCNTTSECPPPVITRIQPETGPLGGGIRITILGSNLGVQAGDIQRISV
AGRNCSFQPERYSVSTRIVCVIEAAETPFTGGVEVDVFGKLGRSPPNVQFTFQQPKPLSV
EPQQGPQAGGTTLTIHGTHLDTGSQEDVRVTLNGVPCKVTKFGAQLQCVTGPQATRGQML
LEVSYGGSPVPNPGIFFTYRENPVLRAFEPLRSFASGGRSINVTGQGFSLIQRFAMVVIA
EPLQSWQPPREAESLQPMTVVGTDYVFHNDTKVVFLSPAVPEEPEAYNLTVLIEMDGHRA
LLRTEAGAFEYVPDPTFENFTGGVKKQVNKLIHARGTNLNKAMTLQEAEAFVGAERCTMK
TLTETDLYCEPPEVQPPPKRRQKRDTTHNLPEFIVKFGSREWVLGRVEYDTRVSDVPLSL
ILPLVIVPMVVVIAVSVYCYWRKSQQAEREYEKIKSQLEGLEESVRDRCKKEFTDLMIEM
EDQTNDVHEAGIPVLDYKTYTDRVFFLPSKDGDKDVMITGKLDIPEPRRPVVEQALYQFS
NLLNSKSFLINFIHTLENQREFSARAKVYFASLLTVALHGKLEYYTDIMHTLFLELLEQY
VVAKNPKLMLRRSETVVERMLSNWMSICLYQYLKDSAGEPLYKLFKAIKHQVEKGPVDAV
QKKAKYTLNDTGLLGDDVEYAPLTVSVIVQDEGVDAIPVKVLNCDTISQVKEKIIDQVYR
GQPCSCWPRPDSVVLEWRPGSTAQILSDLDLTSQREGRWKRVNTLMHYNVRDGATLILSK
VGVSQQPEDSQQDLPGERHALLEEENRVWHLVRPTDEVDEGKSKRGSVKEKERTKAITEI
YLTRLLSVKGTLQQFVDNFFQSVLAPGHAVPPAVKYFFDFLDEQAEKHNIQDEDTIHIWK
TNSLPLRFWVNILKNPHFIFDVHVHEVVDASLSVIAQTFMDACTRTEHKLSRDSPSNKLL
YAKEISTYKKMVEDYYKGIRQMVQVSDQDMNTHLAEISRAHTDSLNTLVALHQLYQYTQK
YYDEIINALEEDPAAQKMQLAFRLQQIAAALENKVTDL
NT seq 5517 nt NT seq  +upstreamnt  +downstreamnt
atggcactgcagctctgggccctgaccctgctgggcctgctgggcgcaggtgccagcctg
aggccccgcaagctggacttcttccgcagcgagaaagagctgaaccacctggctgtggat
gaggcctcaggcgtggtgtacctgggggcggtgaatgccctctaccagctggatgcgaag
ctgcagctggagcagcaggtggccacgggcccggccctggacaacaagaagtgcacgccg
cccatcgaggccagccagtgccatgaggctgagatgactgacaatgtcaaccagctgctg
ctgctcgaccctcccaggaagcgcctggtggagtgcggcagcctcttcaagggcatctgc
gctctgcgcgccctgagcaacatctccctccgcctgttctacgaggacggcagcggggag
aagtctttcgtggccagcaatgatgagggcgtggccacagtggggctggtgagctccacg
ggtcctggtggtgaccgcgtgctgtttgtgggcaaaggcaatgggccacacgacaacggc
atcatcgtgagcactcggctgttggaccggactgacagcagggaggcctttgaagcctac
acggaccacgccacctacaaggccggctacctgtccaccaacacacagcagttcgtggcg
gccttcgaggacggcccctacgtcttctttgtcttcaaccagcaggacaagcacccggcc
cggaaccgcacgctgctggcacgcatgtgcagagaagaccccaactactactcctacctg
gagatggacctgcagtgccgggaccccgacatccacgccgctgcctttggcacctgcctg
gccgcctccgtggctgcgcctggctctggcagggtgctatatgctgtcttcagcagagac
agccggagcagtggggggcccggtgcgggcctctgcctgttcccgctggacaaggtgcac
gccaagatggaggccaaccgcaacgcctgttacacaggcacccgggaggcccgtgacatc
ttctacaagcccttccacggcgatatccagtgcggcggccacgcgccgggctccagcaag
agcttcccatgtggctcggagcacctgccctacccgctgggcagccgcgacgggctcaga
ggcacagccgtgctgcagcgtggaggcctgaacctcacggccgtgacggtcgccgccgag
aacaaccacactgttgcttttctgggcacctctgatggccggatcctcaaggtgtacctc
accccagatggcacctcctcagagtacgactctatccttgtggagataaacaagagagtc
aagcgcgacctggtactgtctggagacctgggcagcctgtacgccatgacccaggacaag
gtgttccggctgccggtgcaggagtgcctgagctacccgacctgcacccagtgccgcgac
tcccaggacccctactgcggctggtgcgtcgtcgagggacgatgcacccggaaggccgag
tgtccgcgggccgaggaggccagccactggctgtggagccgaagcaagtcctgcgtggcc
gtcaccagcgcccagccacagaacatgagccggcgggcccagggggaggtgcagctgacc
gtcagccccctccctgccctgagcgaggaggacgagttgctgtgcctttttggggagtcg
ccgccacaccccgcccgcgtggagggcgaggccgtcatctgcaactccccaagcagcatc
cccgtcacaccgccaggccaggaccacgtggccgtgaccatccagctcctccttagacga
ggcaacatcttcctcacgtcctaccagtaccccttctacgactgccgccaggccatgagc
ctggaggagaacctgccgtgcatctcctgcgtgagcaaccgctggacctgccagtgggac
ctgcgctaccacgagtgccgggaggcttcgcccaaccctgaggacggcatcgtccgtgcc
cacatggaggacagctgtccccagttcctgggacccagccccctggtgatccccatgaac
cacgagacagatgtgaacttccagggcaagaacctggacaccgtgaagggttcctccctg
cacgtgggcagtgacttgctcaagttcatggagccggtgaccatgcaggaatctgggacc
ttcgcctttcggaccccaaagctgtcccacgatgccaacgagacgctgcccctgcacctc
tacgtcaagtcttacggcaagaatatcgacagcaagctccatgtgaccctctacaactgc
tcctttggccgcagcgactgcagcctgtgccgggccgctaaccccgactacaggtgtgcg
tggtgcgggggccagagcaggtgcgtgtatgaggccctgtgcaacaccacctccgagtgc
ccgccgcccgtcatcaccaggatccagcctgagacgggccccctgggtgggggcatccgc
atcaccatcctggggtccaatttgggcgtccaagcaggggacatccagaggatctctgtg
gccggccggaactgctcctttcagccggaacgttactccgtgtccacccggatcgtgtgt
gtgatcgaggctgcggagacgcctttcacggggggtgtcgaggtggacgtcttcgggaaa
ctgggccgttcgcctcccaatgtccagttcaccttccaacagcccaagcctctcagtgtg
gagccgcagcagggaccgcaggcgggcggcaccacactgaccatccacggcacccacctg
gacacgggctcccaggaggacgtgcgggtgaccctcaacggcgtcccgtgtaaagtgacg
aagtttggggcgcagctccagtgtgtcactggcccccaggcgacacggggccagatgctt
ctggaggtctcctacggggggtcccccgtgcccaaccccggcatcttcttcacctaccgc
gaaaaccccgtactgcgagccttcgagccgctacgaagctttgccagtggtggccgcagc
atcaacgtcacgggtcagggcttcagcctgatccagaggtttgccatggtggtcatcgcg
gagcccctgcagtcctggcagccgccgcgggaggctgaatccctgcagcccatgacggtg
gtgggtacagactacgtgttccacaatgacaccaaggtcgtcttcctgtccccggctgtg
cctgaggagccagaggcctacaacctcacggtgctgatcgagatggacgggcaccgtgcc
ctgctcagaacagaggccggggccttcgagtacgtgcctgaccccacctttgagaacttc
acaggtggcgtcaagaagcaggtcaacaagctcatccacgcccggggcaccaatctgaac
aaggcgatgacgctgcaggaggccgaggccttcgtgggtgccgagcgctgcaccatgaag
acgctgacggagaccgacctgtactgtgagcccccggaggtgcagcccccgcccaagcgg
cggcagaaacgagacaccacacacaacctgcccgagttcattgtgaagttcggctctcgc
gagtgggtgctgggccgcgtggagtacgacacacgggtgagcgacgtgccgctcagcctc
atcttgccgctggtcatcgtgcccatggtggtcgtcatcgcggtgtctgtctactgctac
tggaggaagagccagcaggccgaacgagagtatgagaagatcaagtcccagctggagggc
ctggaggagagcgtgcgggaccgctgcaagaaggaattcacagacctgatgatcgagatg
gaggaccagaccaacgacgtgcacgaggccggcatccccgtgctggactacaagacctac
accgaccgcgtcttcttcctgccctccaaggacggcgacaaggacgtgatgatcaccggc
aagctggacatccctgagccgcggcggccggtggtggagcaggccctctaccagttctcc
aacctgctgaacagcaagtctttcctcatcaatttcatccacaccctggagaaccagcgg
gagttctcggcccgcgccaaggtctacttcgcgtccctgctgacggtggcgctgcacggg
aaactggagtactacacggacatcatgcacacgctcttcctggagctcctggagcagtac
gtggtggccaagaaccccaagctgatgctgcgcaggtctgagactgtggtggagaggatg
ctgtccaactggatgtccatctgcctgtaccagtacctcaaggacagtgccggggagccc
ctgtacaagctcttcaaggccatcaaacatcaggtggaaaagggcccggtggatgcggta
cagaagaaggccaagtacactctcaacgacacggggctgctgggggatgatgtggagtac
gcacccctgacggtgagcgtgatcgtgcaggacgagggagtggacgccatcccggtgaag
gtcctcaactgtgacaccatctcccaggtcaaggagaagatcattgaccaggtgtaccgt
gggcagccctgctcctgctggcccaggccagacagcgtggtcctggagtggcgtccgggc
tccacagcgcagatcctgtcggacctggacctgacgtcacagcgggagggccggtggaag
cgcgtcaacacccttatgcactacaatgtccgggatggagccaccctcatcctgtccaag
gtgggggtctcccagcagccggaggacagccagcaggacctgcctggggagcgccatgcc
ctcctggaggaggagaaccgggtgtggcacctggtgcggccgaccgacgaggtggacgag
ggcaagtccaagagaggcagcgtgaaagagaaggagcggacgaaggccatcaccgagatc
tacctgacgcggctgctctcagtcaagggcacactgcagcagtttgtggacaacttcttc
cagagcgtgctggcgcctgggcacgcggtgccacctgcagtcaagtacttcttcgacttc
ctggacgagcaggcagagaagcacaacatccaggatgaagacaccatccacatctggaag
acgaacagcttaccgctccggttctgggtgaacatcctcaagaacccccacttcatcttt
gacgtgcatgtccacgaggtggtggacgcctcgctgtcagtcatcgcgcagaccttcatg
gatgcctgcacgcgcacggagcataagctgagccgcgattctcccagcaacaagctgctg
tacgccaaggagatctccacctacaagaagatggtggaggattactacaaggggatccgg
cagatggtgcaggtcagcgaccaggacatgaacacacacctggcagagatttcccgggcg
cacacggactccttgaacaccctcgtggcactccaccagctctaccaatacacgcagaag
tactatgacgagatcatcaatgccttggaggaggatcctgccgcccagaagatgcagctg
gccttccgcctgcagcagattgccgctgcactggagaacaaggtcactgacctctga

KEGG   Homo sapiens (human): 5364Help
Entry
5364              CDS       T01001                                 

Gene name
PLXNB1, PLEXIN-B1, PLXN5, SEP
Definition
(RefSeq) plexin B1
  KO
K06821  plexin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    5364 (PLXNB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 PSI TIG_plexin
Motif
Other DBs
NCBI-GeneID: 5364
NCBI-ProteinID: NP_001123554
OMIM: 601053
HGNC: 9103
Ensembl: ENSG00000164050
Vega: OTTHUMG00000133527
Pharos: O43157(Tbio)
UniProt: O43157
LinkDB All DBs
Structure
PDB: 

Position
3p21.31
AA seq 2135 aa AA seqDB search
MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSP
GLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCE
QRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGG
IPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQ
SRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSA
APPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDV
NSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAF
LGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVA
SCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMS
PANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLP
RGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLC
THKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTAT
ASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRP
SATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALD
WLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGL
WELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLE
VVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLY
DCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTG
PVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGA
TAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVG
DQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPT
KSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSS
QQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTL
QPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPP
VEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLL
ALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLG
SGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFI
HTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTE
TVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLL
REDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDP
RTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRE
NQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLT
RLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNS
LPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYAR
DIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYD
QIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL
NT seq 6408 nt NT seq  +upstreamnt  +downstreamnt
atgcctgctctgggcccagctcttctccaggctctctgggccgggtgggtcctcaccctc
cagccccttccaccaactgcattcactcccaatggcacgtatctgcagcacctggcaagg
gaccccacctcaggcaccctctacctgggggctaccaacttcctgttccagctgagccct
gggctgcagctggaggccacagtgtccaccggccctgtgctagacagcagggactgcctg
ccacctgtgatgcctgatgagtgcccccaggcccagcctaccaacaacccgaatcagctg
ctcctggtgagcccaggggccctggtggtatgcgggagcgtgcaccagggggtctgtgaa
cagcggcgcctggggcagctcgagcagctgctgctgcggccagagcggcctggggacaca
caatatgtggctgccaatgatcctgcggtcagcacggtggggctggtagcccagggcttg
gcaggggagcccctcctgtttgtggggcgaggatacaccagcaggggtgtggggggtggc
attccacccatcacaacccgggccctgtggccgcccgacccccaagctgccttctcctat
gaggagacagccaagctggcagtgggccgcctctccgagtacagccaccacttcgtgagt
gcctttgcacgtggggccagcgcctacttcctgttcctgcggcgggacctgcaggctcag
tctagagcttttcgtgcctatgtatctcgagtgtgtctccgggaccagcactactactcc
tatgtggagttgcctctggcctgcgaaggtggccgctacgggctgatccaggctgcagct
gtggccacgtccagggaggtggcgcatggggaggtgctctttgcagctttctcctcggct
gcaccccccactgtgggccggcccccatcggcggctgctggggcatctggagcctctgcc
ctctgtgccttccccctggatgaggtggaccggcttgctaatcgcacgcgagatgcctgc
tacacccgggagggtcgtgctgaggatgggaccgaggtggcctacatcgagtatgatgtc
aattctgactgtgcacagctgccagtggacaccctggatgcttatccctgtggctcagac
cacacgcccagccccatggccagccgggtcccgctggaagccacaccaattctggagtgg
ccagggattcagctaacagctgtggcagtcaccatggaagatggacacaccatcgctttc
ctgggtgatagtcaagggcagctgcacagggtctacttgggcccagggagcgatggccac
ccatactccacacagagcatccagcaggggtctgcagtgagcagagacctcacctttgat
gggacctttgagcacctgtatgtcatgacccagagcacacttctgaaggttcctgtggct
tcctgtgctcagcacctggactgtgcatcttgccttgctcacagggacccatactgtggg
tggtgcgtgctccttggcaggtgcagtcgccgttctgagtgctcgaggggccagggccca
gagcagtggctatggagcttccagcctgagctgggctgtctgcaagtggcagccatgagt
cctgccaacatcagccgagaggagacgagggaggttttcctatcagtgccagacctgcca
cccctgtggccaggggagtcatattcctgccactttggggaacatcagagtcctgccctg
ctgactggttctggtgtgatgtgcccctccccagaccctagtgaggccccagtgctgccg
agaggagccgactacgtatccgtgagcgtggagctcagatttggcgctgttgtgatcgcc
aaaacttccctctctttctatgactgtgtggcggtcactgaactccgcccatctgcgcag
tgccaggcctgtgtgagcagccgctgggggtgtaactggtgtgtctggcagcacctgtgc
acccacaaggcctcgtgtgatgctgggcccatggttgcaagccatcagagcccgcttgtc
tccccagaccctcctgcaagaggtggacccagcccctccccacccacagcccccaaagcc
ctggccacccctgctcctgacacccttcccgtggagcctggggctccctccacagccaca
gcttcggacatctcacctggggctagtccttccctgctcagcccctgggggccatgggca
ggttctggctccatatcttcccctggctccacagggtcgcctctccatgaggagccctcc
cctcccagcccccaaaatggacctggaaccgctgtccctgcccccactgacttcagaccc
tcagccacacctgaggacctcttggcctccccgctgtcaccctcagaggtagcagcagtg
ccccctgcagaccctggccccgaggctcttcatcccacagtgcccctggacctgccccct
gccactgttcctgccaccactttcccaggggccatgggctccgtgaagcccgccctggac
tggctcacgagagaaggcggcgagctgcccgaggcggacgagtggacggggggtgacgca
cccgccttctccacttccaccctcctctcaggtgatggagactcagcagagcttgagggc
cctcccgcccccctcatcctcccgtccagcctcgactaccagtatgacacccccgggctc
tgggagctggaagaggcgaccttgggggcaagctcctgcccctgtgtggagagcgttcag
ggctccacgttgatgccggtccatgtggagcgggaaatccggctgctaggcaggaacctg
caccttttccaggatggcccaggagacaatgagtgtgtgatggagctggagggcctcgag
gtggtggttgaggcccgggtcgagtgtgagccacctccagatacccagtgccatgtcacc
tgccagcagcaccagctcagctatgaggctctgcagccggagctccgtgtggggctgttt
ctgcgtcgggccggccgtctgcgtgtggacagtgctgaggggctgcatgtggtactgtat
gactgttccgtgggacatggagactgcagccgctgccaaactgccatgccccagtatggc
tgtgtgtggtgtgagggggagcgtccacgttgtgtgacccgggaggcctgtggtgaggct
gaggctgtggccacccagtgcccagcgcccctcatccactcggtggagccactgactggg
cctgtagacggaggcacccgtgtcaccatcaggggctccaacctgggccagcatgtgcag
gatgtgctgggcatggtcacggtggctggagtgccctgtgctgtggatgcccaggagtac
gaggtctccagcagcctcgtgtgcatcaccggggccagtggggaggaggtggccggcgcc
acagcggtggaggtgccgggaagaggacgtggtgtctcagaacacgactttgcctaccag
gatccgaaggtccattccatcttcccggcccgcggccccagagctgggggcacccgtctc
accctgaatggctccaagctcctgactgggcggctggaggacatccgagtggtggttgga
gaccagccttgtcacttgctgccggagcagcagtcagaacaactgcggtgtgagaccagc
ccacgccccacgcctgccacgctccctgtggctgtgtggtttggggccacggagcggagg
cttcaacgcggacagttcaagtataccttggaccccaacatcacctctgctggccccacc
aagagcttcctcagtggaggacgtgagatatgcgtccgtggccagaatctggacgtggta
cagacgccaagaatccgggtgaccgtggtctcgagaatgctgcagcccagccaggggctt
ggacggaggcgtcgcgtggtcccggagacggcatgttcccttggaccctcctgcagtagc
cagcaatttgaggagccgtgccatgtcaactcctcccagctcatcacgtgccgcacacct
gccctcccaggcctgcctgaggacccctgggtccgggtggaatttatccttgacaacctg
gtctttgactttgcaacactgaaccccacacctttctcctatgaggccgaccccaccctg
cagccactcaaccctgaggaccccaccatgccattccggcacaagcctgggagtgtgttc
tccgtggagggggagaacctggaccttgcaatgtccaaggaggaggtggtggctatgata
ggggatggcccctgtgtggtgaagacgctgacgcggcaccacctgtactgcgagcccccc
gtggagcagcccctgccacggcaccatgccctccgagaggcacctgactctttgcctgag
ttcacggtgcagatggggaacttgcgcttctccctgggtcacgtgcagtatgacggcgag
agccctggggcttttcctgtggcagcccaggtgggcttgggggtgggcacctctcttctg
gctctgggtgtcatcatcattgtcctcatgtacaggaggaagagcaagcaggccctgagg
gactataagaaggttcagatccagctggagaatctggagagcagtgtgcgggaccgctgc
aagaaggaattcacagacctcatgactgagatgaccgatctcaccagtgacctcctgggc
agcggcatccccttcctcgactacaaggtgtatgcggagaggatcttcttccctgggcac
cgcgagtcgcccttgcaccgggacctgggtgtgcctgagagcagacggcccactgtggag
caagggctggggcagctctctaacctgctcaacagcaagctcttcctcaccaagttcatc
cacacgctggagagccagcgcaccttttcagctcgggaccgtgcctacgtggcatctctg
ctcaccgtggcactgcatgggaagcttgagtatttcactgacatcctccgcactctgctc
agtgacctggttgcccagtatgtggccaagaaccccaagctgatgctgcgcaggacagag
actgtggtggagaagctgctcaccaactggatgtccatctgtctgtataccttcgtgagg
gactccgtaggggagcctctgtacatgctctttcgagggattaagcaccaagtggataag
gggccagtggacagtgtgacaggcaaggccaaatacaccttgaacgacaaccgcctgctc
agagaggatgtggagtaccgtcccctgaccttgaatgcactattggctgtggggcctggg
gcaggagaggcccagggcgtgcccgtgaaggtcctagactgtgacaccatctcccaggca
aaggagaagatgctggaccagctttataaaggagtgcctctcacccagcggccagaccct
cgcacccttgatgttgagtggcggtctggggtggccgggcacctcattctttctgacgag
gatgtcacttctgaggtccagggtctgtggaggcgcctgaacacactgcagcattacaag
gtcccagatggagcaactgtggccctcgtcccctgcctcaccaagcatgtgctccgggaa
aaccaggattatgtccctggagagcggaccccaatgctggaggatgtagatgaggggggc
atccggccctggcacctggtgaagccaagtgatgagccggagccgcccaggcctcggagg
ggcagccttcggggcggggagcgtgagcgcgccaaggccatccctgagatctacctgacc
cgcctgctgtccatgaagggcaccctgcagaagttcgtggatgacctgttccaggtgatt
ctcagcaccagccgccccgtgccgctcgctgtgaagtacttctttgacctgctggatgag
caggcccagcagcatggcatctccgaccaggacaccatccacatctggaagaccaacagc
ttgcctctgaggttctggatcaatataataaaaaacccgcagtttgtgttcgacgtgcaa
acatctgataacatggatgcggtgctccttgtcattgcacagaccttcatggacgcctgc
accctggccgaccacaagctgggccgggactccccgatcaacaaacttctgtatgcacgg
gacattccccggtacaagcggatggtggaaaggtactatgcagacatcagacagactgtc
ccagccagcgaccaagagatgaactctgtcctggctgaactgtcctggaactactccgga
gacctcggggcgcgagtggccctgcatgaactctacaagtacatcaacaagtactatgac
cagatcatcactgccctggaggaggatggcacggcccagaagatgcagctgggctatcgg
ctccagcagattgcagctgctgtggaaaacaaggtcacagatctatag

KEGG   Homo sapiens (human): 5365Help
Entry
5365              CDS       T01001                                 

Gene name
PLXNB3, PLEXB3, PLEXR, PLXN6
Definition
(RefSeq) plexin B3
  KO
K06821  plexin B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04360  Axon guidance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    5365 (PLXNB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Plexin_cytopl Sema TIG TIG_2 TIG_plexin PSI
Motif
Other DBs
NCBI-GeneID: 5365
NCBI-ProteinID: NP_005384
OMIM: 300214
HGNC: 9105
Ensembl: ENSG00000198753
Vega: OTTHUMG00000024217
Pharos: Q9ULL4(Tbio)
UniProt: Q9ULL4 A8K920
LinkDB All DBs
Position
Xq28
AA seq 1909 aa AA seqDB search
MCHAAQETPLLHHFMAPVMARWPPFGLCLLLLLLSPPPLPLTGAHRFSAPNTTLNHLALA
PGRGTLYVGAVNRLFQLSPELQLEAVAVTGPVIDSPDCVPFRDPAECPQAQLTDNANQLL
LVSSRAQELVACGQVRQGVCETRRLGDVAEVLYQAEDPGDGQFVAANTPGVATVGLVVPL
PGRDLLLVARGLAGKLSAGVPPLAIRQLAGSQPFSSEGLGRLVVGDFSDYNNSYVGAFAD
ARSAYFVFRRRGARAQAEYRSYVARVCLGDTNLYSYVEVPLACQGQGLIQAAFLAPGTLL
GVFAAGPRGTQAALCAFPMVELGASMEQARRLCYTAGGRGPSGAEEATVEYGVTSRCVTL
PLDSPESYPCGDEHTPSPIAGRQPLEVQPLLKLGQPVSAVAALQADGHMIAFLGDTQGQL
YKVFLHGSQGQVYHSQQVGPPGSAISPDLLLDSSGSHLYVLTAHQVDRIPVAACPQFPDC
ASCLQAQDPLCGWCVLQGRCTRKGQCGRAGQLNQWLWSYEEDSHCLHIQSLLPGHHPRQE
QGQVTLSVPRLPILDADEYFHCAFGDYDSLAHVEGPHVACVTPPQDQVPLNPPGTDHVTV
PLALMFEDVTVAATNFSFYDCSAVQALEAAAPCRACVGSIWRCHWCPQSSHCVYGEHCPE
GERTIYSAQEVDIQVRGPGACPQVEGLAGPHLVPVGWESHLALRVRNLQHFRGLPASFHC
WLELPGELRGLPATLEETAGDSGLIHCQAHQFYPSMSQRELPVPIYVTQGEAQRLDNTHA
LYVILYDCAMGHPDCSHCQAANRSLGCLWCADGQPACRYGPLCPPGAVELLCPAPSIDAV
EPLTGPPEGGLALTILGSNLGRAFADVQYAVSVASRPCNPEPSLYRTSARIVCVTSPAPN
GTTGPVRVAIKSQPPGISSQHFTYQDPVLLSLSPRWGPQAGGTQLTIRGQHLQTGGNTSA
FVGGQPCPILEPVCPEAIVCRTRPQAAPGEAAVLVVFGHAQRTLLASPFRYTANPQLVAA
EPSASFRGGGRLIRVRGTGLDVVQRPLLSVWLEADAEVQASRAQPQDPQPRRSCGAPAAD
PQACIQLGGGLLQCSTVCSVNSSSLLLCRSPAVPDRAHPQRVFFTLDNVQVDFASASGGQ
GFLYQPNPRLAPLSREGPARPYRLKPGHVLDVEGEGLNLGISKEEVRVHIGRGECLVKTL
TRTHLYCEPPAHAPQPANGSGLPQFVVQMGNVQLALGPVQYEAEPPLSAFPVEAQAGVGM
GAAVLIAAVLLLTLMYRHKSKQALRDYQKVLVQLESLETGVGDQCRKEFTDLMTEMTDLS
SDLEGSGIPFLDYRTYAERAFFPGHGGCPLQPKPEGPGEDGHCATVRQGLTQLSNLLNSK
LFLLTLIHTLEEQPSFSQRDRCHVASLLSLALHGKLEYLTDIMRTLLGDLAAHYVHRNPK
LMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYMLFRAIQYQVDKGPVDAVTGKAKRT
LNDSRLLREDVEFQPLTLMVLVGPGAGGAAGSSEMQRVPARVLDTDTITQVKEKVLDQVY
KGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGL
VPQLHRGSTISQSLAQRCPLGENIPTLEDGEEGGVCLWHLVKATEEPEGAKVRCSSLRER
EPARAKAIPEIYLTRLLSMKGTLQKFVDDTFQAILSVNRPIPIAVKYLFDLLDELAEKHG
IEDPGTLHIWKTNSLLLRFWVNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTTSEHK
VGRDSPVNKLLYAREIPRYKQMVERYYADIRQSSPASYQEMNSALAELSGNYTSAPHCLE
ALQELYNHIHRYYDQIISALEEDPVGQKLQLACRLQQVAALVENKVTDL
NT seq 5730 nt NT seq  +upstreamnt  +downstreamnt
atgtgccacgccgcccaggagacccctctgctgcaccacttcatggcccccgtgatggct
cgctggcctcccttcggcctctgcctcctcctgctgctgctgtccccaccgccactgccc
ttgacaggggcccatcgcttctccgcacctaataccactctcaaccacttggcactggca
cctggccgaggcacactctatgtcggcgcagtgaaccgcctcttccagctcagccccgag
ctgcagctcgaggccgtggctgtcactggccctgtaatcgacagccctgactgcgtgccc
ttccgtgacccagccgagtgcccacaggcccagctcactgacaatgccaaccagctgctg
ctggtgagcagccgcgcccaggagctggtggcctgcgggcaggtgcggcagggcgtgtgt
gagacacggcgccttggggatgtggccgaggtgctgtaccaggctgaggaccctggtgac
gggcagtttgtggctgccaataccccgggagtggcaacggtggggctggtggtgcccttg
cccggccgggacctcctgcttgtggccagaggcctggcgggcaagctgtcggcaggggtg
ccacccctggccatccgccagctggccgggtctcagcccttctccagcgagggcctgggc
cgcctggtggtgggcgacttctccgactacaacaacagctacgtcggggcctttgccgac
gcccgctccgcctacttcgtgttccgccgccgcggggcccgggcccaggctgagtaccgc
tcctacgtggcccgcgtctgcctgggggacaccaacctgtactcctacgtggaggtcccc
ctcgcctgccagggccagggcctcatccaggccgccttccttgccccgggcaccttgcta
ggggtgtttgccgcgggcccaaggggcacccaggcggcgctctgtgccttccccatggtg
gagctgggtgccagcatggagcaggcccggagactctgctacacggcgggcggccggggc
cccagcggcgcagaggaagccaccgtggagtacggcgtcacgtcgcgctgcgtcaccctg
ccccttgattcccccgagtcgtacccctgtggcgacgagcacacccccagccccattgct
ggccgccagcccctggaggtccagcctctgctgaagctcgggcagccggtcagcgccgtg
gcagctctccaggcagatgggcacatgatagccttcctgggggacacccagggccagctg
tacaaggtctttctccacggctcccagggccaggtttaccactcccagcaagtggggcct
ccaggctcagccatcagcccagacctgctgctggacagcagtggcagtcacctctatgtc
ctgactgcccaccaggtggaccggatacctgtggcagcctgcccccagttccctgactgt
gccagctgcctccaggcccaggacccgctgtgtggctggtgtgtcctccagggcaggtgt
acccggaagggccagtgcgggcgggcaggccagctgaaccagtggctgtggagttatgag
gaggacagccactgcctgcacatccagagcctgctgccgggccaccacccccgccaggag
cagggccaggtcactttgtctgtcccccggctgcccatcctggatgcagatgaatacttc
cattgtgcgttcggggactatgacagcttggctcatgtggaagggccccacgtggcctgt
gtcacccctccccaagaccaggtgccacttaaccctccaggcacagaccacgtcactgtg
cccctggccctgatgttcgaggacgtgactgtggctgccaccaacttctccttttatgac
tgcagtgccgtccaggccttggaggcggctgccccgtgtcgcgcttgcgtgggcagcatc
tggcggtgtcactggtgcccgcagagtagccactgcgtgtacggagagcactgcccagag
ggcgagaggaccatctacagcgcccaggaggtggacatccaggtgcgtggcccaggggct
tgcccacaggtcgaaggcctggcaggtccccacctggtgcctgtgggctgggagagccat
ttggccctacgcgtgcggaaccttcaacatttccgaggcctgcctgcctccttccactgc
tggctggagctgcctggagaacttcggggactgccggccaccctggaggagacagcaggg
gattcaggcctcatccactgccaggcccaccagttttatccctccatgtcccagcgggag
ctcccagtgcccatctacgtcacccagggtgaagcccagaggctggacaacacccatgct
ctttatgtgatcctgtacgactgcgccatgggccacccggactgcagccactgccaagcg
gccaacaggagcctgggctgcctgtggtgtgctgacggccagcctgcctgtcgctatggg
cccttgtgcccgccgggggctgtggagctgctgtgtcctgcgcccagcattgatgcagtc
gagcccctgaccggtccccctgagggaggcttggccctcaccatcctgggctccaacctg
ggccgggccttcgccgatgtgcagtacgccgtgagcgtggccagccggccctgcaaccct
gagccctctctctaccgcacgtcggcccggattgtgtgtgtgacatctcctgcccccaat
ggcaccactgggcccgtccgggtggccattaagagccagccaccaggcatctcaagccag
cacttcacctaccaggaccctgtcctgctgagcctgagtcctcgctggggcccccaggca
gggggcacccagctcaccatccgaggtcagcacctccagacaggtggcaacaccagtgcc
ttcgtgggtggccaaccctgtcccatcctggagccagtgtgtccggaggccatcgtgtgc
cgtaccaggccccaggctgccccaggagaagcagcggtccttgtggtctttggccatgcc
cagcgcacactgctcgccagccccttccgctacaccgccaacccccagcttgtagcggcg
gagcccagtgccagcttccgggggggtgggcgactgatccgtgtcaggggcaccggccta
gacgtggtgcagcggcccctactgtctgtgtggctggaggctgacgcagaggtgcaggct
tccagggcccagccccaggacccacagccaaggaggagctgtggagcccctgctgcggac
ccccaggcttgtatccagctcggtggggggctgctgcagtgctccaccgtctgctccgtc
aactcgtccagcctcctcctgtgccggagccctgctgtaccagacagagcccacccgcag
cgggtcttcttcaccctagacaacgtgcaagtggacttcgccagtgccagtgggggccag
ggcttcctgtaccagcccaacccccgcctggcacccctcagccgcgaggggcctgcccgc
ccctaccgcctcaagccaggccatgtcctggatgtggagggcgagggcctcaacctgggc
atcagcaaggaggaggtgcgcgtgcacatcggccgcggcgagtgcctggtgaagacgctc
acgcgcacccacctgtactgcgagccgcctgcgcacgccccgcagcctgccaatggctcc
ggcctgccacagttcgtggtgcagatgggcaatgtgcagctggccctgggccctgtgcag
tacgaggctgaacccccgctgtctgcctttcccgtggaggcccaggcaggcgtgggcatg
ggtgctgcagtgctgattgccgccgtgctcctcctcaccctcatgtacaggcacaagagc
aagcaggccctgcgggactaccagaaggtgctagtgcagctggagagcctggagaccggc
gtgggagaccagtgccgcaaggagttcacagacctcatgacggagatgaccgacctcagc
agcgacctggagggcagcgggatccccttcctggactaccgcacctacgccgagcgcgcc
ttcttccctggccatggcggttgcccgctgcagcccaagcctgaggggccaggggaggac
ggccactgtgccactgtgcgccagggcctcacgcagctctccaacctgctcaacagcaag
ctcttcctcctcacgctcatccacaccctggaggagcagcccagcttttcccagagggat
cgctgccatgtggcttcgctgctgtcgctagcgctacacggcaagctggagtacctgacg
gacatcatgaggaccctgctgggtgacctggcggcccattacgtgcacaggaaccccaag
ctcatgctacgcaggacagagaccatggtggagaaactgctcaccaactggctgtccatc
tgcctgtacgccttcctgagggaggtggctggtgaaccactgtacatgctcttccgggcc
atccagtaccaggtggacaaaggccccgtggacgccgtgacaggcaaggccaaacggacc
ctgaatgatagccgcttgctgcgggaggacgtggagttccagcccctgacgctgatggtg
ctggtggggcccggggctggcggggccgcaggcagcagcgagatgcagcgcgtgccagcc
cgggtgctcgacacggacaccatcacccaggtcaaggagaaggtgttggaccaagtctac
aagggcacccccttctcccagaggccctcagtgcatgccctagaccttgagtggcgctca
ggcctggctggtcacctgaccctatcggacgaagacttgacctccgtgacccaaaaccac
tggaagagactcaacaccttgcaacactacaaggtcccagatggagcaacagtggggctc
gtccctcagctgcaccgtggcagcaccatctcccagagcctggcccagaggtgccccttg
ggagagaacatacccacgctggaggatggcgaggaggggggggtgtgcctctggcacctg
gtgaaagccaccgaggagccagaaggggccaaggtgcggtgcagcagcctgcgggagcgc
gagccagcaagggccaaggccattccggaaatctacctcacccgtctgctgtccatgaag
ggcacgctgcagaagtttgtggacgacaccttccaggccattctcagcgtgaaccggccc
atccccatcgccgtcaagtacctgtttgaccttctggatgagctagcagagaagcacggc
atcgaggacccagggaccctgcacatctggaagaccaacagtctgctgctgcggttctgg
gtgaatgccttgaagaacccacagctcatctttgatgtacgggtgtcggacaatgtggac
gccatccttgctgtcatcgcccagaccttcattgactcctgtaccacctcggagcataaa
gtgggccgggattccccagtgaacaaactgctctacgcccgggagatcccacgctacaag
cagatggtggagaggtactatgcggacattcgccagagctctccggcgagctaccaggag
atgaactctgctttggctgagctctccgggaactacacttctgctccccactgtctggag
gctctgcaagaactctacaaccacatccacaggtactatgatcagattatcagtgccctg
gaggaggaccctgtgggccagaagctgcagctggcctgccgcctgcagcaggtcgccgcc
ctggtggaaaacaaagtgactgacctgtga

DBGET integrated database retrieval system