KEGG   Homo sapiens (human): 23673Help
Entry
23673             CDS       T01001                                 

Gene name
STX12, STX13, STX14
Definition
(RefSeq) syntaxin 12
  KO
K13813  syntaxin 12/13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04145  Phagosome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    23673 (STX12)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    23673 (STX12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    23673 (STX12)
Membrane trafficking [BR:hsa04131]
 SNARE
  Syntaxin (Qa)
   Stx-Endo
    23673 (STX12)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   23673 (STX12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syntaxin_2 SNARE Syntaxin DUF3784 TMCO5 DUF2776 MMTV_SAg DUF3040
Motif
Other DBs
NCBI-GeneID: 23673
NCBI-ProteinID: NP_803173
OMIM: 606892
HGNC: 11430
Ensembl: ENSG00000117758
Vega: OTTHUMG00000003730
Pharos: Q86Y82(Tbio)
UniProt: Q86Y82
LinkDB All DBs
Structure
PDB: 

Position
1p35.3
AA seq 276 aa AA seqDB search
MSYGPLDMYRNPGPSGPQLRDFSSIIQTCSGNIQRISQATAQIKNLMSQLGTKQDSSKLQ
ENLQQLQHSTNQLAKETNELLKELGSLPLPLSTSEQRQQRLQKERLMNDFSAALNNFQAV
QRRVSEKEKESIARARAGSRLSAEERQREEQLVSFDSHEEWNQMQSQEDEVAITEQDLEL
IKERETAIRQLEADILDVNQIFKDLAMMIHDQGDLIDSIEANVESSEVHVERATEQLQRA
AYYQKKSRKKMCILVLVLSVIILILGLIIWLVYKTK
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacggtcccttagacatgtaccggaacccggggccctcggggccccagctccgg
gacttcagcagcatcatccagacgtgcagcggcaacatccagcggatcagccaagccact
gctcagataaagaatttgatgagccagctaggaactaagcaggactcaagcaagctacag
gaaaatctgcaacagttacaacactccacaaatcagctcgccaaggaaacaaatgaattg
ctgaaagaattagggtccttgccccttcccttatctacttcagaacagcgccagcagaga
cttcagaaggaacgcctcatgaatgacttctctgcagccttaaacaatttccaggctgtg
cagagaagggtatctgaaaaggaaaaggagagtattgccagagcaagagctggatctcgt
ctttctgcagaagagaggcaaagagaggagcagctggtctcatttgacagccatgaggag
tggaaccagatgcagagccaggaggatgaggtggccatcactgagcaggatttggaactt
attaaagaaagagaaacggcaattcggcagctggaggctgacattttggatgtcaatcag
atatttaaagatttggccatgatgatccatgaccagggtgatctgattgatagcatagaa
gccaatgtggaaagctcagaggtgcacgtcgaaagagccactgaacagttacagcgagct
gcttactatcagaaaaaatctcgcaagaagatgtgtatcctggtgcttgtcctgtcagtg
attattctaatcttgggacttattatctggctagtttataaaacgaagtga

DBGET integrated database retrieval system