KEGG   Homo sapiens (human): 23683Help
Entry
23683             CDS       T01001                                 

Gene name
PRKD3, EPK2, PKC-NU, PKD3, PRKCN, nPKC-NU
Definition
(RefSeq) protein kinase D3
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    23683 (PRKD3)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    23683 (PRKD3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    23683 (PRKD3)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     23683 (PRKD3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PKD family
   23683 (PRKD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9 RIO1 Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 23683
NCBI-ProteinID: NP_005804
OMIM: 607077
HGNC: 9408
Ensembl: ENSG00000115825
Vega: OTTHUMG00000100961
Pharos: O94806(Tchem)
UniProt: O94806
LinkDB All DBs
Structure
PDB: 

Position
2p22.2
AA seq 890 aa AA seqDB search
MSANNSPPSAQKSVLPTAIPAVLPAASPCSSPKTGLSARLSNGSFSAPSLTNSRGSVHTV
SFLLQIGLTRESVTIEAQELSLSAVKDLVCSIVYQKFPECGFFGMYDKILLFRHDMNSEN
ILQLITSADEIHEGDLVEVVLSALATVEDFQIRPHTLYVHSYKAPTFCDYCGEMLWGLVR
QGLKCEGCGLNYHKRCAFKIPNNCSGVRKRRLSNVSLPGPGLSVPRPLQPEYVALPSEES
HVHQEPSKRIPSWSGRPIWMEKMVMCRVKVPHTFAVHSYTRPTICQYCKRLLKGLFRQGM
QCKDCKFNCHKRCASKVPRDCLGEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDT
EEPSPPEDKMFFLDPSDLDVERDEEAVKTISPSTSNNIPLMRVVQSIKHTKRKSSTMVKE
GWMVHYTSRDNLRKRHYWRLDSKCLTLFQNESGSKYYKEIPLSEILRISSPRDFTNISQG
SNPHCFEIITDTMVYFVGENNGDSSHNPVLAATGVGLDVAQSWEKAIRQALMPVTPQASV
CTSPGQGKDHKDLSTSISVSNCQIQENVDISTVYQIFADEVLGSGQFGIVYGGKHRKTGR
DVAIKVIDKMRFPTKQESQLRNEVAILQNLHHPGIVNLECMFETPERVFVVMEKLHGDML
EMILSSEKSRLPERITKFMVTQILVALRNLHFKNIVHCDLKPENVLLASAEPFPQVKLCD
FGFARIIGEKSFRRSVVGTPAYLAPEVLRSKGYNRSLDMWSVGVIIYVSLSGTFPFNEDE
DINDQIQNAAFMYPPNPWREISGEAIDLINNLLQVKMRKRYSVDKSLSHPWLQDYQTWLD
LREFETRIGERYITHESDDARWEIHAYTHNLVYPKHFIMAPNPDDMEEDP
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaaataattcccctccatcagcccagaagtctgtattacccacagctattcct
gctgtgcttccagctgcttctccgtgttcaagtcctaagacgggactctctgcccgactc
tctaatggaagcttcagtgcaccatcactcaccaactccagaggctcagtgcatacagtt
tcatttctactgcaaattggcctcacacgggagagtgttaccattgaagcccaggaactg
tctttatctgctgtcaaggatcttgtgtgctccatagtttatcaaaagtttccagagtgt
ggattctttggcatgtatgacaaaattcttctctttcgccatgacatgaactcagaaaac
attttgcagctgattacctcagcagatgaaatacatgaaggagacctagtggaagtggtt
ctttcagctttagccacagtagaagacttccagattcgtccacatactctctatgtacat
tcttacaaagctcctactttctgtgattactgtggtgagatgctctggggattggtacgt
caaggactgaaatgtgaaggctgtggattaaattaccataaacgatgtgccttcaagatt
ccaaataactgtagtggagtaagaaagagacgtctgtcaaatgtatctttaccaggaccc
ggcctctcagttccaagacccctacagcctgaatatgtagcccttcccagtgaagagtca
catgtccaccaggaaccaagtaagagaattccttcttggagtggtcgcccaatctggatg
gaaaagatggtaatgtgcagagtgaaagttccacacacatttgctgttcactcttacacc
cgtcccacgatatgtcagtactgcaagcggttactgaaaggcctctttcgccaaggaatg
cagtgtaaagattgcaaattcaactgccataaacgctgtgcatcaaaagtaccaagagac
tgccttggagaggttactttcaatggagaaccttccagtctgggaacagatacagatata
ccaatggatattgacaataatgacataaatagtgatagtagtcggggtttggatgacaca
gaagagccatcacccccagaagataagatgttcttcttggatccatctgatctcgatgtg
gaaagagatgaagaagccgttaaaacaatcagtccatcaacaagcaataatattccgcta
atgagggttgtacaatccatcaagcacacaaagaggaagagcagcacaatggtgaaggaa
gggtggatggtccattacaccagcagggataacctgagaaagaggcattattggagactt
gacagcaaatgtctaacattatttcagaatgaatctggatcaaagtattataaggaaatt
ccactttcagaaattctccgcatatcttcaccacgagatttcacaaacatttcacaaggc
agcaatccacactgttttgaaatcattactgatactatggtatacttcgttggtgagaac
aatggggacagctctcataatcctgttcttgctgccactggagttggacttgatgtagca
cagagctgggaaaaagcaattcgccaagccctcatgcctgttactcctcaagcaagtgtt
tgcacttctccagggcaagggaaagatcacaaagatttgtctacaagtatctctgtatct
aattgtcagattcaggagaatgtggatatcagtactgtttaccagatctttgcagatgag
gtgcttggttcaggccagtttggcatcgtttatggaggaaaacatagaaagactgggagg
gatgtggctattaaagtaattgataagatgagattccccacaaaacaagaaagtcaactc
cgtaatgaagtggctattttacagaatttgcaccatcctgggattgtaaacctggaatgt
atgtttgaaaccccagaacgagtctttgtagtaatggaaaagctgcatggagatatgttg
gaaatgattctatccagtgagaaaagtcggcttccagaacgaattactaaattcatggtc
acacagatacttgttgctttgaggaatctgcattttaagaatattgtgcactgtgattta
aagccagaaaatgtgctgcttgcatcagcagagccatttcctcaggtgaagctgtgtgac
tttggatttgcacgcatcattggtgaaaagtcattcaggagatctgtggtaggaactcca
gcatacttagcccctgaagttctccggagcaaaggttacaaccgttccctagatatgtgg
tcagtgggagttatcatctatgtgagcctcagtggcacatttccttttaatgaggatgaa
gatataaatgaccaaatccaaaatgctgcatttatgtacccaccaaatccatggagagaa
atttctggtgaagcaattgatctgataaacaatctgcttcaagtgaagatgagaaaacgt
tacagtgttgacaaatctcttagtcatccctggctacaggactatcagacttggcttgac
cttagagaatttgaaactcgcattggagaacgttacattacacatgaaagtgatgatgct
cgctgggaaatacatgcatacacacataaccttgtatacccaaagcacttcattatggct
cctaatccagatgatatggaagaagatccttaa

KEGG   Homo sapiens (human): 25865Help
Entry
25865             CDS       T01001                                 

Gene name
PRKD2, HSPC187, PKD2, nPKC-D2
Definition
(RefSeq) protein kinase D2
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    25865 (PRKD2)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    25865 (PRKD2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    25865 (PRKD2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     25865 (PRKD2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PKD family
   25865 (PRKD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 C1_2 Kinase-like Kdo zf-RING_9 ABC1 APH
Motif
Other DBs
NCBI-GeneID: 25865
NCBI-ProteinID: NP_001073349
OMIM: 607074
HGNC: 17293
Ensembl: ENSG00000105287
Vega: OTTHUMG00000183431
Pharos: Q9BZL6(Tchem)
UniProt: Q9BZL6
LinkDB All DBs
Structure
PDB: 

Position
19q13.32
AA seq 878 aa AA seqDB search
MATAPSYPAGLPGSPGPGSPPPPGGLELQSPPPLLPQIPAPGSGVSFHIQIGLTREFVLL
PAASELAHVKQLACSIVDQKFPECGFYGLYDKILLFKHDPTSANLLQLVRSSGDIQEGDL
VEVVLSASATFEDFQIRPHALTVHSYRAPAFCDHCGEMLFGLVRQGLKCDGCGLNYHKRC
AFSIPNNCSGARKRRLSSTSLASGHSVRLGTSESLPCTAEELSRSTTELLPRRPPSSSSS
SSASSYTGRPIELDKMLLSKVKVPHTFLIHSYTRPTVCQACKKLLKGLFRQGLQCKDCKF
NCHKRCATRVPNDCLGEALINGDVPMEEATDFSEADKSALMDESEDSGVIPGSHSENALH
ASEEEEGEGGKAQSSLGYIPLMRVVQSVRHTTRKSSTTLREGWVVHYSNKDTLRKRHYWR
LDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGE
MPGGTPGGPSGQGAEAARGWETAIRQALMPVILQDAPSAPGHAPHRQASLSISVSNSQIQ
ENVDIATVYQIFPDEVLGSGQFGVVYGGKHRKTGRDVAVKVIDKLRFPTKQESQLRNEVA
ILQSLRHPGIVNLECMFETPEKVFVVMEKLHGDMLEMILSSEKGRLPERLTKFLITQILV
ALRHLHFKNIVHCDLKPENVLLASADPFPQVKLCDFGFARIIGEKSFRRSVVGTPAYLAP
EVLLNQGYNRSLDMWSVGVIMYVSLSGTFPFNEDEDINDQIQNAAFMYPASPWSHISAGA
IDLINNLLQVKMRKRYSVDKSLSHPWLQEYQTWLDLRELEGKMGERYITHESDDARWEQF
AAEHPLPGSGLPTDRDLGGACPPQDHDMQGLAERISVL
NT seq 2637 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgccccctcttatcccgccgggctccctggctctcccgggccggggtctcct
ccgccccccggcggcctagagctgcagtcgccgccaccgctactgccccagatcccggcc
ccgggttccggggtctcctttcacatccagatcgggctgacccgcgagttcgtgctgttg
cccgccgcctccgagctggctcatgtgaagcagctggcctgttccatcgtggaccagaag
ttccctgagtgtggcttctacggcctttacgacaagatcctgcttttcaaacatgacccc
acgtcggccaacctcctgcagctggtgcgctcgtccggagacatccaggagggcgacctg
gtggaggtggtgctgtcggcctcggccaccttcgaggacttccagatccgcccgcacgcc
ctcacggtgcactcctatcgggcgcctgccttctgtgatcactgcggggagatgctcttc
ggcctagtgcgccagggcctcaagtgcgatggctgcgggctgaactaccacaagcgctgt
gccttcagcatccccaacaactgtagtggggcccgcaaacggcgcctgtcatccacgtct
ctggccagtggccactcggtgcgcctcggcacctccgagtccctgccctgcacggctgaa
gagctgagccgtagcaccaccgaactcctgcctcgccgtcccccgtcatcctcttcctcc
tcttctgcctcatcgtatacgggccgccccattgagctggacaagatgctgctctccaag
gtcaaggtgccgcacaccttcctcatccacagctatacacggcccaccgtttgccaggct
tgcaagaaactcctcaagggcctcttccggcagggcctgcaatgcaaagactgcaagttt
aactgtcacaaacgctgcgccacccgcgtccctaatgactgcctgggggaggcccttatc
aatggagatgtgccgatggaggaggccaccgatttcagcgaggctgacaagagcgccctc
atggatgagtcagaggactccggtgtcatccctggctcccactcagagaatgcgctccac
gccagtgaggaggaggaaggcgagggaggcaaggcccagagctccctggggtacatcccc
ctaatgagggtggtgcaatcggtgcgacacacgacgcggaaatccagcaccacgctgcgg
gagggttgggtggttcattacagcaacaaggacacgctgagaaagcggcactattggcgc
ctggactgcaagtgtatcacgctcttccagaacaacacgaccaacagatactataaggaa
attccgctgtcagaaatcctcacggtggagtccgcccagaacttcagccttgtgccgccg
ggcaccaacccacactgctttgagatcgtcactgccaatgccacctacttcgtgggcgag
atgcctggcgggactccgggtgggccaagtgggcagggggctgaggccgcccggggctgg
gagacagccatccgccaggccctgatgcccgtcatccttcaggacgcacccagcgcccca
ggccacgcgccccacagacaagcttctctgagcatctctgtgtccaacagtcagatccaa
gagaatgtggacattgccactgtctaccagatcttccctgacgaagtgctgggctcaggg
cagtttggagtggtctatggaggaaaacaccggaagacaggccgggacgtggcagttaag
gtcattgacaaactgcgcttccctaccaagcaggagagccagctccggaatgaagtggcc
attctgcagagcctgcggcatcccgggatcgtgaacctggagtgcatgttcgagacgcct
gagaaagtgtttgtggtgatggagaagctgcatggggacatgttggagatgatcctgtcc
agtgagaagggccggctgcctgagcgcctcaccaagttcctcatcacccagatcctggtg
gctttgagacaccttcacttcaagaacattgtccactgtgacttgaaaccagaaaacgtg
ttgctggcatcagcagacccatttcctcaggtgaagctgtgtgactttggctttgctcgc
atcatcggcgagaagtcgttccgccgctcagtggtgggcacgccggcctacctggcaccc
gaggtgctgctcaaccagggctacaaccgctcgctggacatgtggtcagtgggcgtgatc
atgtacgtcagcctcagcggcaccttccctttcaacgaggatgaggacatcaatgaccag
atccagaacgccgccttcatgtacccggccagcccctggagccacatctcagctggagcc
attgacctcatcaacaacctgctgcaggtgaagatgcgcaaacgctacagcgtggacaaa
tctctcagccacccctggttacaggagtaccagacgtggctggacctccgagagctggag
gggaagatgggagagcgatacatcacgcatgagagtgacgacgcgcgctgggagcagttt
gcagcagagcatccgctgcctgggtctgggctgcccacggacagggatctcggtggggcc
tgtccaccacaggaccacgacatgcaggggctggcggagcgcatcagtgttctctga

KEGG   Homo sapiens (human): 5587Help
Entry
5587              CDS       T01001                                 

Gene name
PRKD1, CHDED, PKC-MU, PKCM, PKD, PRKCM
Definition
(RefSeq) protein kinase D1
  KO
K06070  protein kinase D [EC:2.7.11.13]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    5587 (PRKD1)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    5587 (PRKD1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    5587 (PRKD1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     5587 (PRKD1)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  PKD family
   5587 (PRKD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr C1_1 PH Kinase-like C1_2 Kdo zf-RING_9
Motif
Other DBs
NCBI-GeneID: 5587
NCBI-ProteinID: NP_002733
OMIM: 605435
HGNC: 9407
Ensembl: ENSG00000184304
Vega: OTTHUMG00000140203
Pharos: Q15139(Tchem)
UniProt: Q15139
LinkDB All DBs
Position
14q12
AA seq 912 aa AA seqDB search
MSAPPVLRPPSPLLPVAAAAAAAAAALVPGSGPGPAPFLAPVAAPVGGISFHLQIGLSRE
PVLLLQDSSGDYSLAHVREMACSIVDQKFPECGFYGMYDKILLFRHDPTSENILQLVKAA
SDIQEGDLIEVVLSASATFEDFQIRPHALFVHSYRAPAFCDHCGEMLWGLVRQGLKCEGC
GLNYHKRCAFKIPNNCSGVRRRRLSNVSLTGVSTIRTSSAELSTSAPDEPLLQKSPSESF
IGREKRSNSQSYIGRPIHLDKILMSKVKVPHTFVIHSYTRPTVCQYCKKLLKGLFRQGLQ
CKDCRFNCHKRCAPKVPNNCLGEVTINGDLLSPGAESDVVMEEGSDDNDSERNSGLMDDM
EEAMVQDAEMAMAECQNDSGEMQDPDPDHEDANRTISPSTSNNIPLMRVVQSVKHTKRKS
STVMKEGWMVHYTSKDTLRKRHYWRLDSKCITLFQNDTGSRYYKEIPLSEILSLEPVKTS
ALIPNGANPHCFEITTANVVYYVGENVVNPSSPSPNNSVLTSGVGADVARMWEIAIQHAL
MPVIPKGSSVGTGTNLHRDISVSISVSNCQIQENVDISTVYQIFPDEVLGSGQFGIVYGG
KHRKTGRDVAIKIIDKLRFPTKQESQLRNEVAILQNLHHPGVVNLECMFETPERVFVVME
KLHGDMLEMILSSEKGRLPEHITKFLITQILVALRHLHFKNIVHCDLKPENVLLASADPF
PQVKLCDFGFARIIGEKSFRRSVVGTPAYLAPEVLRNKGYNRSLDMWSVGVIIYVSLSGT
FPFNEDEDIHDQIQNAAFMYPPNPWKEISHEAIDLINNLLQVKMRKRYSVDKTLSHPWLQ
DYQTWLDLRELECKIGERYITHESDDLRWEKYAGEQGLQYPTHLINPSASHSDTPETEET
EMKALGERVSIL
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcccctccggtcctgcggccgcccagtccgctgctgcccgtggcggcggcagct
gccgcagcggccgccgcactggtcccagggtccgggcccgggcccgcgccgttcttggct
cctgtcgcggccccggtcgggggcatctcgttccatctgcagatcggcctgagccgtgag
ccggtgctgctgctgcaggactcgtccggggactacagcctggcgcacgtccgcgagatg
gcttgctccattgtcgaccagaagttccctgaatgtggtttctacggaatgtatgataag
atcctgctttttcgccatgaccctacctctgaaaacatccttcagctggtgaaagcggcc
agtgatatccaggaaggcgatcttattgaagtggtcttgtcagcttccgccacctttgaa
gactttcagattcgtccccacgctctctttgttcattcatacagagctccagctttctgt
gatcactgtggagaaatgctgtgggggctggtacgtcaaggtcttaaatgtgaagggtgt
ggtctgaattaccataagagatgtgcatttaaaatacccaacaattgcagcggtgtgagg
cggagaaggctctcaaacgtttccctcactggggtcagcaccatccgcacatcatctgct
gaactctctacaagtgcccctgatgagccccttctgcaaaaatcaccatcagagtcgttt
attggtcgagagaagaggtcaaattctcaatcatacattggacgaccaattcaccttgac
aagattttgatgtctaaagttaaagtgccgcacacatttgtcatccactcctacacccgg
cccacagtgtgccagtactgcaagaagcttctgaaggggcttttcaggcagggcttgcag
tgcaaagattgcagattcaactgccataaacgttgtgcaccgaaagtaccaaacaactgc
cttggcgaagtgaccattaatggagatttgcttagccctggggcagagtctgatgtggtc
atggaagaagggagtgatgacaatgatagtgaaaggaacagtgggctcatggatgatatg
gaagaagcaatggtccaagatgcagagatggcaatggcagagtgccagaacgacagtggc
gagatgcaagatccagacccagaccacgaggacgccaacagaaccatcagtccatcaaca
agcaacaatatcccactcatgagggtagtgcagtctgtcaaacacacgaagaggaaaagc
agcacagtcatgaaagaaggatggatggtccactacaccagcaaggacacgctgcggaaa
cggcactattggagattggatagcaaatgtattaccctctttcagaatgacacaggaagc
aggtactacaaggaaattcctttatctgaaattttgtctctggaaccagtaaaaacttca
gctttaattcctaatggggccaatcctcattgtttcgaaatcactacggcaaatgtagtg
tattatgtgggagaaaatgtggtcaatccttccagcccatcaccaaataacagtgttctc
accagtggcgttggtgcagatgtggccaggatgtgggagatagccatccagcatgccctt
atgcccgtcattcccaagggctcctccgtgggtacaggaaccaacttgcacagagatatc
tctgtgagtatttcagtatcaaattgccagattcaagaaaatgtggacatcagcacagta
tatcagatttttcctgatgaagtactgggttctggacagtttggaattgtttatggagga
aaacatcgtaaaacaggaagagatgtagctattaaaatcattgacaaattacgatttcca
acaaaacaagaaagccagcttcgtaatgaggttgcaattctacagaaccttcatcaccct
ggtgttgtaaatttggagtgtatgtttgagacgcctgaaagagtgtttgttgttatggaa
aaactccatggagacatgctggaaatgatcttgtcaagtgaaaagggcaggttgccagag
cacataacgaagtttttaattactcagatactcgtggctttgcggcaccttcattttaaa
aatatcgttcactgtgacctcaaaccagaaaatgtgttgctagcctcagctgatcctttt
cctcaggtgaaactttgtgattttggttttgcccggatcattggagagaagtctttccgg
aggtcagtggtgggtacccccgcttacctggctcctgaggtcctaaggaacaagggctac
aatcgctctctagacatgtggtctgttggggtcatcatctatgtaagcctaagcggcaca
ttcccatttaatgaagatgaagacatacacgaccaaattcagaatgcagctttcatgtat
ccaccaaatccctggaaggaaatatctcatgaagccattgatcttatcaacaatttgctg
caagtaaaaatgagaaagcgctacagtgtggataagaccttgagccacccttggctacag
gactatcagacctggttagatttgcgagagctggaatgcaaaatcggggagcgctacatc
acccatgaaagtgatgacctgaggtgggagaagtatgcaggcgagcaggggctgcagtac
cccacacacctgatcaatccaagtgctagccacagtgacactcctgagactgaagaaaca
gaaatgaaagccctcggtgagcgtgtcagcatcctctga

DBGET integrated database retrieval system