KEGG   Homo sapiens (human): 23786
Entry
23786             CDS       T01001                                 

Gene name
BCL2L13, BCL-RAMBO, Bcl2-L-13, MIL1
Definition
(RefSeq) BCL2 like 13
  KO
K15485  Bcl-2-like protein 13
Organism
hsa  Homo sapiens (human)
Pathway
hsa04137  Mitophagy - animal
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    23786 (BCL2L13)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    23786 (BCL2L13)
SSDB
Motif
Pfam: Bcl-2 CEND1
Other DBs
NCBI-GeneID: 23786
NCBI-ProteinID: NP_056182
HGNC: 17164
Ensembl: ENSG00000099968
Vega: OTTHUMG00000150088
Pharos: Q9BXK5(Tbio)
UniProt: Q9BXK5
LinkDB
Position
22q11.21
AA seq 485 aa
MASSSTVPLGFHYETKYVVLSYLGLLSQEKLQEQHLSSPQGVQLDIASQSLDQEILLKVK
TEIEEELKSLDKEISEAFTSTGFDRHTSPVFSPANPESSMEDCLAHLGEKVSQELKEPLH
KALQMLLSQPVTYQAFRECTLETTVHASGWNKILVPLVLLRQMLLELTRRGQEPLSALLQ
FGVTYLEDYSAEYIIQQGGWGTVFSLESEEEEYPGITAEDSNDIYILPSDNSGQVSPPES
PTVTTSWQSESLPVSLSASQSWHTESLPVSLGPESWQQIAMDPEEVKSLDSNGAGEKSEN
NSSNSDIVHVEKEEVPEGMEEAAVASVVLPARELQEALPEAPAPLLPHITATSLLGTREP
DTEVITVEKSSPATSLFVELDEEEVKAATTEPTEVEEVVPALEPTETLLSEKEINAREES
LVEELSPASEKKPVPPSEGKSRLSPAGEMKPMPLSEGKSILLFGGAAAVAILAVAIGVAL
ALRKK
NT seq 1458 nt   +upstreamnt  +downstreamnt
atggcgtcctcttctactgtgcctctgggatttcactatgaaacaaagtatgttgttctc
agctacttgggactcctctctcaagagaagctgcaagagcaacatctttcctcaccccaa
ggggttcaactagatatagcttcacaatctctggatcaagaaattttattaaaagttaaa
actgaaattgaagaagagctaaaatctctggacaaagaaatttctgaagccttcaccagc
acaggctttgaccgtcacacttctccagtgttcagccctgccaatccagaaagctcaatg
gaagactgcttggcccatcttggagaaaaagtgtcccaggaactgaaagagcctctccat
aaagcattgcaaatgctcctgagccagccagtgacatatcaggcatttcgggaatgtaca
ctggagaccacagttcatgccagcggctggaataagattttggtgcctctggttttgcta
cgacaaatgcttttggaattgacaagacgtggtcaagaacctttgagcgcactgctgcag
tttggcgtgacatacctggaggactattcggcagagtacatcattcagcaaggtggctgg
ggcactgtgtttagtcttgagtcagaggaggaggaataccctggaatcactgcagaagat
agcaatgacatttacatcctgcccagcgacaactctggacaagtcagtcccccagagtct
ccaactgtgaccacttcctggcagtctgagagcttacctgtgtcactgtcagctagccag
agttggcacacagaaagcctgccagtgtcactaggccctgagtcctggcagcagattgca
atggatcctgaagaagtgaaaagcttagacagcaacggagctggagagaagagtgagaac
aactcctctaattctgacattgtgcacgtggagaaagaagaggtgcccgagggcatggaa
gaggctgctgtggcttctgtggtcttgccagcgcgggagctgcaagaggcacttcctgaa
gccccagctcccttgcttccacatatcactgccacctccctgctggggacaagggaacct
gacacagaagtgatcacagttgagaaatccagccctgctacatctctgtttgtagaactt
gatgaagaagaggtgaaagcagcaacaactgaacctactgaagtggaggaggtggtcccc
gcactggaacccacagaaacgctgctgagtgagaaggagataaacgcaagggaagagagc
cttgtggaagagctgtcccctgccagcgagaagaagcccgtgccgccgtctgagggcaag
tctagactgtcccccgccggtgagatgaagcccatgccgctgtctgagggcaagtctata
ctgctgtttggaggggctgctgctgttgccatcctggcagtggccatcggggtagccctg
gctctgagaaagaaatag

DBGET integrated database retrieval system