KEGG   Homo sapiens (human): 238Help
Entry
238               CDS       T01001                                 

Gene name
ALK, CD246, NBLST3
Definition
(RefSeq) ALK receptor tyrosine kinase
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05200  Pathways in cancer
hsa05223  Non-small cell lung cancer
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Network
nt06210  ERK signaling
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06266  Non-small cell lung cancer
  Element
N00007  EML4-ALK fusion kinase to RAS-ERK signaling pathway
N00025  EML4-ALK fusion kinase to PLCG-ERK signaling pathway
N00047  EML4-ALK fusion kinase to PI3K signaling pathway
N00105  EML4-ALK fusion kinase to Jak-STAT signaling pathway
N10003  First-generation tyrosine kinase inhibitor to ALK fusion
N10004  Second/third-generation tyrosine kinase inhibitor to ALK fusion
Disease
H00014  Non-small cell lung cancer
H01601  Anaplastic large-cell lymphoma
H01892  Peripheral T cell lymphoma
Drug target
Alectinib (DG01625): D10450 D10542
Brigatinib: D10866
Ceritinib: D10551
Crizotinib: D09731
Ensartinib (DG02996): D11346 D11356
Entrectinib: D10926
Lorlatinib: D11012 D11012
Repotrectinib: D11454
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    238 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    238 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    238 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    238 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    238 (ALK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     238 (ALK)
Protein kinases [BR:hsa01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   238 (ALK)
CD molecules [BR:hsa04090]
 Proteins
  238 (ALK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Ldl_recept_a FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 238
NCBI-ProteinID: NP_004295
OMIM: 105590
HGNC: 427
Ensembl: ENSG00000171094
Vega: OTTHUMG00000152034
Pharos: Q9UM73(Tclin)
UniProt: Q9UM73 B6D4Y2
LinkDB All DBs
Structure
PDB: 

Position
2p23.2-p23.1
AA seq 1620 aa AA seqDB search
MGAIGLLWLLPLLLSTAAVGSGMGTGQRAGSPAAGPPLQPREPLSYSRLQRKSLAVDFVV
PSLFRVYARDLLLPPSSSELKAGRPEARGSLALDCAPLLRLLGPAPGVSWTAGSPAPAEA
RTLSRVLKGGSVRKLRRAKQLVLELGEEAILEGCVGPPGEAAVGLLQFNLSELFSWWIRQ
GEGRLRIRLMPEKKASEVGREGRLSAAIRASQPRLLFQIFGTGHSSLESPTNMPSPSPDY
FTWNLTWIMKDSFPFLSHRSRYGLECSFDFPCELEYSPPLHDLRNQSWSWRRIPSEEASQ
MDLLDGPGAERSKEMPRGSFLLLNTSADSKHTILSPWMRSSSEHCTLAVSVHRHLQPSGR
YIAQLLPHNEAAREILLMPTPGKHGWTVLQGRIGRPDNPFRVALEYISSGNRSLSAVDFF
ALKNCSEGTSPGSKMALQSSFTCWNGTVLQLGQACDFHQDCAQGEDESQMCRKLPVGFYC
NFEDGFCGWTQGTLSPHTPQWQVRTLKDARFQDHQDHALLLSTTDVPASESATVTSATFP
APIKSSPCELRMSWLIRGVLRGNVSLVLVENKTGKEQGRMVWHVAAYEGLSLWQWMVLPL
LDVSDRFWLQMVAWWGQGSRAIVAFDNISISLDCYLTISGEDKILQNTAPKSRNLFERNP
NKELKPGENSPRQTPIFDPTVHWLFTTCGASGPHGPTQAQCNNAYQNSNLSVEVGSEGPL
KGIQIWKVPATDTYSISGYGAAGGKGGKNTMMRSHGVSVLGIFNLEKDDMLYILVGQQGE
DACPSTNQLIQKVCIGENNVIEEEIRVNRSVHEWAGGGGGGGGATYVFKMKDGVPVPLII
AAGGGGRAYGAKTDTFHPERLENNSSVLGLNGNSGAAGGGGGWNDNTSLLWAGKSLQEGA
TGGHSCPQAMKKWGWETRGGFGGGGGGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFIS
PLGILYTPALKVMEGHGEVNIKHYLNCSHCEVDECHMDPESHKVICFCDHGTVLAEDGVS
CIVSPTPEPHLPLSLILSVVTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKL
SKLRTSTIMTDYNPNYCFAGKTSSISDLKEVPRKNITLIRGLGHGAFGEVYEGQVSGMPN
DPSPLQVAVKTLPEVCSEQDELDFLMEALIISKFNHQNIVRCIGVSLQSLPRFILLELMA
GGDLKSFLRETRPRPSQPSSLAMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCP
GPGRVAKIGDFGMARDIYRASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLW
EIFSLGYMPYPSKSNQEVLEFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIIL
ERIEYCTQDPDVINTALPIEYGPLVEEEEKVPVRPKDPEGVPPLLVSQQAKREEERSPAA
PPPLPTTSSGKAAKKPTAAEISVRVPRGPAVEGGHVNMAFSQSNPPSELHKVHGSRNKPT
SLWNPTYGSWFTEKPTKKNNPIAKKEPHDRGNLGLEGSCTVPPNVATGRLPGASLLLEPS
SLTANMKEVPLFRLRHFPCGNVNYGYQQQGLPLEAATAPGAGHYEDTILKSKNSMNQPGP
NT seq 4863 nt NT seq  +upstreamnt  +downstreamnt
atgggagccatcgggctcctgtggctcctgccgctgctgctttccacggcagctgtgggc
tccgggatggggaccggccagcgcgcgggctccccagctgcggggccgccgctgcagccc
cgggagccactcagctactcgcgcctgcagaggaagagtctggcagttgacttcgtggtg
ccctcgctcttccgtgtctacgcccgggacctactgctgccaccatcctcctcggagctg
aaggctggcaggcccgaggcccgcggctcgctagctctggactgcgccccgctgctcagg
ttgctggggccggcgccgggggtctcctggaccgccggttcaccagccccggcagaggcc
cggacgctgtccagggtgctgaagggcggctccgtgcgcaagctccggcgtgccaagcag
ttggtgctggagctgggcgaggaggcgatcttggagggttgcgtcgggccccccggggag
gcggctgtggggctgctccagttcaatctcagcgagctgttcagttggtggattcgccaa
ggcgaagggcgactgaggatccgcctgatgcccgagaagaaggcgtcggaagtgggcaga
gagggaaggctgtccgcggcaattcgcgcctcccagccccgccttctcttccagatcttc
gggactggtcatagctccttggaatcaccaacaaacatgccttctccttctcctgattat
tttacatggaatctcacctggataatgaaagactccttccctttcctgtctcatcgcagc
cgatatggtctggagtgcagctttgacttcccctgtgagctggagtattcccctccactg
catgacctcaggaaccagagctggtcctggcgccgcatcccctccgaggaggcctcccag
atggacttgctggatgggcctggggcagagcgttctaaggagatgcccagaggctccttt
ctccttctcaacacctcagctgactccaagcacaccatcctgagtccgtggatgaggagc
agcagtgagcactgcacactggccgtctcggtgcacaggcacctgcagccctctggaagg
tacattgcccagctgctgccccacaacgaggctgcaagagagatcctcctgatgcccact
ccagggaagcatggttggacagtgctccagggaagaatcgggcgtccagacaacccattt
cgagtggccctggaatacatctccagtggaaaccgcagcttgtctgcagtggacttcttt
gccctgaagaactgcagtgaaggaacatccccaggctccaagatggccctgcagagctcc
ttcacttgttggaatgggacagtcctccagcttgggcaggcctgtgacttccaccaggac
tgtgcccagggagaagatgagagccagatgtgccggaaactgcctgtgggtttttactgc
aactttgaagatggcttctgtggctggacccaaggcacactgtcaccccacactcctcaa
tggcaggtcaggaccctaaaggatgcccggttccaggaccaccaagaccatgctctattg
ctcagtaccactgatgtccccgcttctgaaagtgctacagtgaccagtgctacgtttcct
gcaccgatcaagagctctccatgtgagctccgaatgtcctggctcattcgtggagtcttg
aggggaaacgtgtccttggtgctagtggagaacaaaaccgggaaggagcaaggcaggatg
gtctggcatgtcgccgcctatgaaggcttgagcctgtggcagtggatggtgttgcctctc
ctcgatgtgtctgacaggttctggctgcagatggtcgcatggtggggacaaggatccaga
gccatcgtggcttttgacaatatctccatcagcctggactgctacctcaccattagcgga
gaggacaagatcctgcagaatacagcacccaaatcaagaaacctgtttgagagaaaccca
aacaaggagctgaaacccggggaaaattcaccaagacagacccccatctttgaccctaca
gttcattggctgttcaccacatgtggggccagcgggccccatggccccacccaggcacag
tgcaacaacgcctaccagaactccaacctgagcgtggaggtggggagcgagggccccctg
aaaggcatccagatctggaaggtgccagccaccgacacctacagcatctcgggctacgga
gctgctggcgggaaaggcgggaagaacaccatgatgcggtcccacggcgtgtctgtgctg
ggcatcttcaacctggagaaggatgacatgctgtacatcctggttgggcagcagggagag
gacgcctgccccagtacaaaccagttaatccagaaagtctgcattggagagaacaatgtg
atagaagaagaaatccgtgtgaacagaagcgtgcatgagtgggcaggaggcggaggagga
gggggtggagccacctacgtatttaagatgaaggatggagtgccggtgcccctgatcatt
gcagccggaggtggtggcagggcctacggggccaagacagacacgttccacccagagaga
ctggagaataactcctcggttctagggctaaacggcaattccggagccgcaggtggtgga
ggtggctggaatgataacacttccttgctctgggccggaaaatctttgcaggagggtgcc
accggaggacattcctgcccccaggccatgaagaagtgggggtgggagacaagagggggt
ttcggagggggtggaggggggtgctcctcaggtggaggaggcggaggatatataggcggc
aatgcagcctcaaacaatgaccccgaaatggatggggaagatggggtttccttcatcagt
ccactgggcatcctgtacaccccagctttaaaagtgatggaaggccacggggaagtgaat
attaagcattatctaaactgcagtcactgtgaggtagacgaatgtcacatggaccctgaa
agccacaaggtcatctgcttctgtgaccacgggacggtgctggctgaggatggcgtctcc
tgcattgtgtcacccaccccggagccacacctgccactctcgctgatcctctctgtggtg
acctctgccctcgtggccgccctggtcctggctttctccggcatcatgattgtgtaccgc
cggaagcaccaggagctgcaagccatgcagatggagctgcagagccctgagtacaagctg
agcaagctccgcacctcgaccatcatgaccgactacaaccccaactactgctttgctggc
aagacctcctccatcagtgacctgaaggaggtgccgcggaaaaacatcaccctcattcgg
ggtctgggccatggcgcctttggggaggtgtatgaaggccaggtgtccggaatgcccaac
gacccaagccccctgcaagtggctgtgaagacgctgcctgaagtgtgctctgaacaggac
gaactggatttcctcatggaagccctgatcatcagcaaattcaaccaccagaacattgtt
cgctgcattggggtgagcctgcaatccctgccccggttcatcctgctggagctcatggcg
gggggagacctcaagtccttcctccgagagacccgccctcgcccgagccagccctcctcc
ctggccatgctggaccttctgcacgtggctcgggacattgcctgtggctgtcagtatttg
gaggaaaaccacttcatccaccgagacattgctgccagaaactgcctcttgacctgtcca
ggccctggaagagtggccaagattggagacttcgggatggcccgagacatctacagggcg
agctactatagaaagggaggctgtgccatgctgccagttaagtggatgcccccagaggcc
ttcatggaaggaatattcacttctaaaacagacacatggtcctttggagtgctgctatgg
gaaatcttttctcttggatatatgccataccccagcaaaagcaaccaggaagttctggag
tttgtcaccagtggaggccggatggacccacccaagaactgccctgggcctgtataccgg
ataatgactcagtgctggcaacatcagcctgaagacaggcccaactttgccatcattttg
gagaggattgaatactgcacccaggacccggatgtaatcaacaccgctttgccgatagaa
tatggtccacttgtggaagaggaagagaaagtgcctgtgaggcccaaggaccctgagggg
gttcctcctctcctggtctctcaacaggcaaaacgggaggaggagcgcagcccagctgcc
ccaccacctctgcctaccacctcctctggcaaggctgcaaagaaacccacagctgcagag
atctctgttcgagtccctagagggccggccgtggaagggggacacgtgaatatggcattc
tctcagtccaaccctccttcggagttgcacaaggtccacggatccagaaacaagcccacc
agcttgtggaacccaacgtacggctcctggtttacagagaaacccaccaaaaagaataat
cctatagcaaagaaggagccacacgacaggggtaacctggggctggagggaagctgtact
gtcccacctaacgttgcaactgggagacttccgggggcctcactgctcctagagccctct
tcgctgactgccaatatgaaggaggtacctctgttcaggctacgtcacttcccttgtggg
aatgtcaattacggctaccagcaacagggcttgcccttagaagccgctactgcccctgga
gctggtcattacgaggataccattctgaaaagcaagaatagcatgaaccagcctgggccc
tga

DBGET integrated database retrieval system