KEGG   Homo sapiens (human): 239
Entry
239               CDS       T01001                                 

Gene name
ALOX12, 12-LOX, 12S-LOX, LOG12
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa01523  Antifolate resistance
hsa04726  Serotonergic synapse
hsa04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    239 (ALOX12)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    239 (ALOX12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    239 (ALOX12)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    239 (ALOX12)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     239 (ALOX12)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 239
NCBI-ProteinID: NP_000688
OMIM: 152391
HGNC: 429
Ensembl: ENSG00000108839
Vega: OTTHUMG00000102088
Pharos: P18054(Tchem)
UniProt: P18054
LinkDB
Structure
PDB: 
3D3L

Position
17p13.1
AA seq 663 aa
MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLL
QFVRLRKHHWLVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNA
LDMFQKHREKELKDRQQIYCWATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKA
GALEMALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQFLNGANPML
LRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFILLDGIPANVIRGEKQYLAAPL
VMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNSDFQLHEIQYH
LLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVH
LFYQRDDIVKGDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQH
AAINQGQLDWYAWVPNAPCTMRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRR
QPDMVPLGHHKEKYFSGPKPKAVLNQFRTDLEKLEKEITARNEQLDWPYEYLKPSCIENS
VTI
NT seq 1992 nt   +upstreamnt  +downstreamnt
atgggccgctaccgcatccgcgtggccaccggggcctggctcttctccgggtcgtacaac
cgcgtgcagctttggctggtcgggacgcgcggggaggcggagctggagctgcagctgcgg
cccgcgcggggcgaggaggaggagtttgatcatgacgttgcagaggacttggggctcctg
cagttcgtgaggctgcgcaagcaccactggctggtggacgacgcgtggttctgcgaccgc
atcacggtgcagggccctggagcctgcgcggaggtggccttcccgtgctaccgctgggtg
cagggcgaggacatcctgagcctgcccgagggcaccgcccgcctgccaggagacaatgct
ttggacatgttccagaagcatcgagagaaggaactgaaagacagacagcagatctactgc
tgggccacctggaaggaagggttacccctgaccatcgctgcagaccgtaaggatgatcta
cctccaaatatgagattccatgaggagaagaggctggactttgaatggacactgaaggca
ggggctctggagatggccctcaaacgtgtttacaccctcctgagctcctggaactgccta
gaagactttgatcagatcttctggggccagaagagtgccctggctgagaaggttcgccag
tgctggcaggatgatgagttgttcagctaccagttcctcaatggtgccaaccccatgctg
ttgagacgctcgacctctctgccctccaggctagtgctgccctcggggatggaagagctt
caggctcaactggagaaagaacttcagaatggttccctgtttgaagctgacttcatcctt
ctggatggaattccagccaacgtgatccgaggagagaagcaatacctggctgcccccctc
gttatgctgaagatggagcccaatgggaagctgcagcccatggtcatccagattcagcct
cccaaccccagctctccaaccccaacactgttcctgccctcagaccccccacttgcctgg
ctcctggcaaagtcctgggtccgaaattcagatttccaactgcacgagatccagtatcac
ttgctgaacactcacctggtggctgaggtcatcgctgtcgccaccatgcggtgcctccca
ggactgcaccccatcttcaagttcctgatcccccatatccgctacaccatggaaatcaac
acccgggcccggacccaactcatctcagatggaggaatttttgataaggcagtgagcaca
ggtggagggggccatgtacagttgctccgtcgggcggcagctcagctgacctactgctcc
ctctgtcctcctgacgacctggctgaccggggcctgctgggactcccaggtgctctctat
gcccatgatgctttacggctctgggagatcattgccaggtatgtggaggggatcgtccac
ctcttctaccaaagggatgacatagtgaagggggaccctgagctgcaggcctggtgtcgg
gagatcacggaggtggggctgtgccaggcccaggaccgaggtttccctgtctccttccag
tcccagagtcaactctgccatttcctcaccatgtgcgtcttcacgtgcactgcccagcat
gccgccatcaaccagggccagctggactggtatgcctgggtccctaatgctccatgcaca
atgcggatgcccccacccaccaccaaggaagatgtgacgatggccacagtgatggggtca
ctacctgatgtccggcaggcctgtcttcaaatggccatctcatggcatctgagtcgccgc
cagccagacatggtgcctctggggcaccacaaagaaaaatatttctcaggccccaagccc
aaagctgtgctaaaccaattccgaacagatttggaaaagctggaaaaggagattacagcc
cggaatgagcaacttgactggccctatgaatatctgaagcccagctgcatagagaacagt
gtcaccatctga

KEGG   Homo sapiens (human): 240
Entry
240               CDS       T01001                                 

Gene name
ALOX5, 5-LO, 5-LOX, 5LPG, LOG5
Definition
(RefSeq) arachidonate 5-lipoxygenase
  KO
K00461  arachidonate 5-lipoxygenase [EC:1.13.11.34]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04664  Fc epsilon RI signaling pathway
hsa04726  Serotonergic synapse
hsa04913  Ovarian steroidogenesis
hsa05145  Toxoplasmosis
Drug target
Atreleuton: D03010
Benoxaprofen: D03080
Benzydamine (except lozenges) (DG00014): D01410 D07516 D07517
Darbufelone mesylate: D03652
Docebenone: D03882
Enazadrem phosphate: D03990
Fenleuton: D04151
Linazolast: D09850
Lonapalene: D04770
Oxatomide: D01773<JP>
Piriprost (DG02899): D05498 D05499
Setileuton: D09667
Tebufelone: D06017
Tepoxalin: D06075
Zileuton: D00414<US>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    240 (ALOX5)
 09150 Organismal Systems
  09151 Immune system
   04664 Fc epsilon RI signaling pathway
    240 (ALOX5)
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    240 (ALOX5)
  09156 Nervous system
   04726 Serotonergic synapse
    240 (ALOX5)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    240 (ALOX5)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.34  arachidonate 5-lipoxygenase
     240 (ALOX5)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 240
NCBI-ProteinID: NP_000689
OMIM: 152390
HGNC: 435
Ensembl: ENSG00000012779
Vega: OTTHUMG00000018081
Pharos: P09917(Tclin)
UniProt: P09917
LinkDB
Structure
PDB: 
3V98 3V99 3O8Y 3V92

Position
10q11.21
AA seq 674 aa
MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
YYLSPDRIPNSVAI
NT seq 2025 nt   +upstreamnt  +downstreamnt
atgccctcctacacggtcaccgtggccactggcagccagtggttcgccggcactgacgac
tacatctacctcagcctcgtgggctcggcgggctgcagcgagaagcacctgctggacaag
cccttctacaacgacttcgagcgtggcgcggtggattcatacgacgtgactgtggacgag
gaactgggcgagatccagctggtcagaatcgagaagcgcaagtactggctgaatgacgac
tggtacctgaagtacatcacgctgaagacgccccacggggactacatcgagttcccctgc
taccgctggatcaccggcgatgtcgaggttgtcctgagggatggacgcgcaaagttggcc
cgagatgaccaaattcacattctcaagcaacaccgacgtaaagaactggaaacacggcaa
aaacaatatcgatggatggagtggaaccctggcttccccttgagcatcgatgccaaatgc
cacaaggatttaccccgtgatatccagtttgatagtgaaaaaggagtggactttgttctg
aattactccaaagcgatggagaacctgttcatcaaccgcttcatgcacatgttccagtct
tcttggaatgacttcgccgactttgagaaaatctttgtcaagatcagcaacactatttct
gagcgggtcatgaatcactggcaggaagacctgatgtttggctaccagttcctgaatggc
tgcaaccctgtgttgatccggcgctgcacagagctgcccgagaagctcccggtgaccacg
gagatggtagagtgcagcctggagcggcagctcagcttggagcaggaggtccagcaaggg
aacattttcatcgtggactttgagctgctggatggcatcgatgccaacaaaacagacccc
tgcacactccagttcctggccgctcccatctgcttgctgtataagaacctggccaacaag
attgtccccattgccatccagctcaaccaaatcccgggagatgagaaccctattttcctc
ccttcggatgcaaaatacgactggcttttggccaaaatctgggtgcgttccagtgacttc
cacgtccaccagaccatcacccaccttctgcgaacacatctggtgtctgaggtttttggc
attgcaatgtaccgccagctgcctgctgtgcaccccattttcaagctgctggtggcacac
gtgagattcaccattgcaatcaacaccaaggcccgtgagcagctcatctgcgagtgtggc
ctctttgacaaggccaacgccacagggggcggtgggcacgtgcagatggtgcagagggcc
atgaaggacctgacctatgcctccctgtgctttcccgaggccatcaaggcccggggcatg
gagagcaaagaagacatcccctactacttctaccgggacgacgggctcctggtgtgggaa
gccatcaggacgttcacggccgaggtggtagacatctactacgagggcgaccaggtggtg
gaggaggacccggagctgcaggacttcgtgaacgatgtctacgtgtacggcatgcggggc
cgcaagtcctcaggcttccccaagtcggtcaagagccgggagcagctgtcggagtacctg
accgtggtgatcttcaccgcctccgcccagcacgccgcggtcaacttcggccagtacgac
tggtgctcctggatccccaatgcgcccccaaccatgcgagccccgccaccgactgccaag
ggcgtggtgaccattgagcagatcgtggacacgctgcccgaccgcggccgctcctgctgg
catctgggtgcagtgtgggcgctgagccagttccaggaaaacgagctgttcctgggcatg
tacccagaagagcattttatcgagaagcctgtgaaggaagccatggcccgattccgcaag
aacctcgaggccattgtcagcgtgattgctgagcgcaacaagaagaagcagctgccatat
tactacttgtccccagaccggattccgaacagtgtggccatctga

KEGG   Homo sapiens (human): 242
Entry
242               CDS       T01001                                 

Gene name
ALOX12B, 12R-LOX, ARCI2
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12R type
  KO
K08021  arachidonate 12-lipoxygenase (R-type) [EC:1.13.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
Disease
H00734  Autosomal recessive congenital ichthyosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    242 (ALOX12B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    242 (ALOX12B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-  
     242 (ALOX12B)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 242
NCBI-ProteinID: NP_001130
OMIM: 603741
HGNC: 430
Ensembl: ENSG00000179477
Vega: OTTHUMG00000108180
Pharos: O75342(Tbio)
UniProt: O75342
LinkDB
Position
17p13.1
AA seq 701 aa
MATYKVRVATGTDLLSGTRDSISLTIVGTQGESHKQLLNHFGRDFATGAVGQYTVQCPQD
LGELIIIRLHKERYAFFPKDPWYCNYVQICAPNGRIYHFPAYQWMDGYETLALREATGKT
TADDSLPVLLEHRKEEIRAKQDFYHWRVFLPGLPSYVHIPSYRPPVRRHRNPNRPEWNGY
IPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIR
KIFPGKKSVVSEYVAEHWAEDTFFGYQYLNGVNPGLIRRCTRIPDKFPVTDDMVAPFLGE
GTCLQAELEKGNIYLADYRIMEGIPTVELSGRKQHHCAPLCLLHFGPEGKMMPIAIQLSQ
TPGPDCPIFLPSDSEWDWLLAKTWVRYAEFYSHEAIAHLLETHLIAEAFCLALLRNLPMC
HPLYKLLIPHTRYTVQINSIGRAVLLNEGGLSAKGMSLGVEGFAGVMVRALSELTYDSLY
LPNDFVERGVQDLPGYYYRDDSLAVWNALEKYVTEIITYYYPSDAAVEGDPELQSWVQEI
FKECLLGRESSGFPRCLRTVPELIRYVTIVIYTCSAKHAAVNTGQMEFTAWMPNFPASMR
NPPIQTKGLTTLETFMDTLPDVKTTCITLLVLWTLSREPDDRRPLGHFPDIHFVEEAPRR
SIEAFRQRLNQISHDIRQRNKCLPIPYYYLDPVLIENSISI
NT seq 2106 nt   +upstreamnt  +downstreamnt
atggccacctacaaagtcagggtggccacaggcaccgacctcttgtcgggaacacgggac
tccatctcactgaccattgtggggacacaaggagagagccataagcagctgctgaaccac
tttgggagagactttgcaactggggcggtgggccagtacaccgtgcagtgccctcaggac
ctgggtgagctcatcatcatccgcctgcacaaagagcggtacgccttcttccccaaggac
ccttggtactgcaactatgtgcagatctgtgcccccaacggccgtatctaccacttcccc
gcctaccagtggatggatggctacgagaccctggcactccgggaggccacaggaaagaca
acagcagatgactcgctccccgtcctcctggagcacagaaaagaggagatcagagccaag
caggacttctaccactggcgagtctttcttcctggcctgcccagctatgtgcacattccc
agttaccgccctccggtgcggaggcatcgcaaccccaaccggcctgagtggaatggctat
attccgggattcccaattctcatcaactttaaggccaccaagttcctgaacttaaatctc
cgctactccttcctcaagacggcctccttcttcgtccgcctggggcccatggcactggct
ttcaaagtccgcggcctgttggactgcaaacattcgtggaagaggctgaaggacattagg
aaaattttccctggcaagaaatctgtcgtctccgagtacgtggccgagcactgggcagag
gacaccttctttgggtaccagtacctcaacggcgtcaaccccggcctgatccgccgctgc
acgcggatcccagacaagttccccgtcacagacgacatggtggctccgttcctgggcgag
ggaacgtgcttgcaagcggagctggagaaggggaacatttacctggccgactaccgcatc
atggagggcatccccaccgtggagctcagcggccggaagcagcaccactgcgcccccctc
tgcctgctgcactttggacccgagggcaagatgatgcccatcgccatccagctcagccag
acccctgggccagattgccccatcttcctgcccagtgattctgagtgggactggctgcta
gccaagacgtgggtacgctatgcggagttctacagccacgaggccatcgcccacctgctg
gagacacacctcattgctgaggccttctgcctggccttgctgaggaacctgcccatgtgc
caccccctctacaagctcctcatcccccatacccgatacaccgtccagatcaacagcatt
ggccgggccgttctcctcaatgagggggggctctctgccaagggcatgtccctgggcgtg
gaaggctttgctggggtgatggtacgggctctgtcggagctcacctatgacagcctctac
ctccccaatgactttgtggagcgtggggtccaggacctgcctggatattactaccgcgat
gacagcttggcggtgtggaatgcactggagaagtatgtgacggagatcatcacctattat
tacccgagtgacgcagccgtggagggtgatccggaattgcagtcttgggtgcaggaaata
tttaaagagtgcctcctggggcgggagagctcaggcttccctaggtgcttgcgaaccgtg
cctgagctgatccgatatgtcactatagtcatctacacctgctctgccaagcacgctgct
gtcaacacaggccagatggagttcaccgcctggatgcccaacttcccagcgtccatgcgg
aatccaccgattcagactaaggggctgaccactctggagaccttcatggacacgttgccg
gatgtgaagaccacgtgcatcacgctgctggtgctctggaccctcagccgagagcctgac
gacaggcggcccctgggacacttcccggacattcacttcgtggaggaggccccgcggagg
agcatagaggcgttccgccagcgcctgaaccagatctcacacgacatccgccagcgcaac
aagtgccttcccatcccctactactacctggacccggtgctgattgagaacagcatttct
atttag

KEGG   Homo sapiens (human): 246
Entry
246               CDS       T01001                                 

Gene name
ALOX15, 12-LOX, 15-LOX, 15-LOX-1, LOG15
Definition
(RefSeq) arachidonate 15-lipoxygenase
  KO
K00460  arachidonate 15-lipoxygenase [EC:1.13.11.33]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa00591  Linoleic acid metabolism
hsa01100  Metabolic pathways
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    246 (ALOX15)
   00591 Linoleic acid metabolism
    246 (ALOX15)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    246 (ALOX15)
   04217 Necroptosis
    246 (ALOX15)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    246 (ALOX15)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     246 (ALOX15)
SSDB
Motif
Pfam: Lipoxygenase PLAT
Other DBs
NCBI-GeneID: 246
NCBI-ProteinID: NP_001131
OMIM: 152392
HGNC: 433
Ensembl: ENSG00000161905
Vega: OTTHUMG00000090746
Pharos: P16050(Tchem)
UniProt: P16050
LinkDB
Position
17p13.2
AA seq 662 aa
MGLYRIRVSTGASLYAGSNNQVQLWLVGQHGEAALGKRLWPARGKETELKVEVPEYLGPL
LFVKLRKRHLLKDDAWFCNWISVQGPGAGDEVRFPCYRWVEGNGVLSLPEGTGRTVGEDP
QGLFQKHREEELEERRKLYRWGNWKDGLILNMAGAKLYDLPVDERFLEDKRVDFEVSLAK
GLADLAIKDSLNVLTCWKDLDDFNRIFWCGQSKLAERVRDSWKEDALFGYQFLNGANPVV
LRRSAHLPARLVFPPGMEELQAQLEKELEGGTLFEADFSLLDGIKANVILCSQQHLAAPL
VMLKLQPDGKLLPMVIQLQLPRTGSPPPPLFLPTDPPMAWLLAKCWVRSSDFQLHELQSH
LLRGHLMAEVIVVATMRCLPSIHPIFKLIIPHLRYTLEINVRARTGLVSDMGIFDQIMST
GGGGHVQLLKQAGAFLTYSSFCPPDDLADRGLLGVKSSFYAQDALRLWEIIYRYVEGIVS
LHYKTDVAVKDDPELQTWCREITEIGLQGAQDRGFPVSLQARDQVCHFVTMCIFTCTGQH
ASVHLGQLDWYSWVPNAPCTMRLPPPTTKDATLETVMATLPNFHQASLQMSITWQLGRRQ
PVMVAVGQHEEEYFSGPEPKAVLKKFREELAALDKEIEIRNAKLDMPYEYLRPSVVENSV
AI
NT seq 1989 nt   +upstreamnt  +downstreamnt
atgggtctctaccgcatccgcgtgtccactggggcctcgctctatgccggttccaacaac
caggtgcagctgtggctggtcggccagcacggggaggcggcgctcgggaagcgactgtgg
cccgcacggggcaaggagacagaactcaaggtggaagtaccggagtatctggggccgctg
ctgtttgtgaaactgcgcaaacggcacctccttaaggacgacgcctggttctgcaactgg
atctctgtgcagggccccggagccggggacgaggtcaggttcccttgttaccgctgggtg
gagggcaacggcgtcctgagcctgcctgaaggcaccggccgcactgtgggcgaggaccct
cagggcctgttccagaaacaccgggaagaagagctggaagagagaaggaagttgtaccgg
tggggaaactggaaggacgggttaattctgaatatggctggggccaaactatatgacctc
cctgtggatgagcgatttctggaagacaagagagttgactttgaggtttcgctggccaag
gggctggccgacctcgctatcaaagactctctaaatgttctgacttgctggaaggatcta
gatgacttcaaccggattttctggtgtggtcagagcaagctggctgagcgcgtgcgggac
tcctggaaggaagatgccttatttgggtaccagtttcttaatggcgccaaccccgtggtg
ctgaggcgctctgctcaccttcctgctcgcctagtgttccctccaggcatggaggaactg
caggcccagctggagaaggagctggagggaggcacactgttcgaagctgacttctccctg
ctggatgggatcaaggccaacgtcattctctgtagccagcagcacctggctgcccctcta
gtcatgctgaaattgcagcctgatgggaaactcttgcccatggtcatccagctccagctg
ccccgcacaggatccccaccacctccccttttcttgcctacggatcccccaatggcctgg
cttctggccaaatgctgggtgcgcagctctgacttccagctccatgagctgcagtctcat
cttctgaggggacacttgatggctgaggtcattgttgtggccaccatgaggtgcctgccg
tcgatacatcctatcttcaagcttataattccccacctgcgatacaccctggaaattaac
gtccgggccaggactgggctggtctctgacatgggaattttcgaccagataatgagcact
ggtgggggaggccacgtgcagctgctcaagcaagctggagccttcctaacctacagctcc
ttctgtccccctgatgacttggccgaccgggggctcctgggagtgaagtcttccttctat
gcccaagatgcgctgcggctctgggaaatcatctatcggtatgtggaaggaatcgtgagt
ctccactataagacagacgtggctgtgaaagacgacccagagctgcagacctggtgtcga
gagatcactgaaatcgggctgcaaggggcccaggaccgagggtttcctgtctctttacag
gctcgggaccaggtttgccactttgtcaccatgtgtatcttcacctgcaccggccaacac
gcctctgtgcacctgggccagctggactggtactcttgggtgcctaatgcaccctgcacg
atgcggctgcccccgccaaccaccaaggatgcaacgctggagacagtgatggcgacactg
cccaacttccaccaggcttctctccagatgtccatcacttggcagctgggcagacgccag
cccgttatggtggctgtgggccagcatgaggaggagtatttttcgggccctgagcctaag
gctgtgctgaagaagttcagggaggagctggctgccctggataaggaaattgagatccgg
aatgcaaagctggacatgccctacgagtacctgcggcccagcgtggtggaaaacagtgtg
gccatctaa

KEGG   Homo sapiens (human): 247
Entry
247               CDS       T01001                                 

Gene name
ALOX15B, 15-LOX-2
Definition
(RefSeq) arachidonate 15-lipoxygenase type B
  KO
K08022  arachidonate 15-lipoxygenase (second type) / 8-lipoxygenase (S-type) [EC:1.13.11.33 1.13.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00590  Arachidonic acid metabolism
hsa01100  Metabolic pathways
hsa04726  Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    247 (ALOX15B)
 09150 Organismal Systems
  09156 Nervous system
   04726 Serotonergic synapse
    247 (ALOX15B)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.33  arachidonate 15-lipoxygenase
     247 (ALOX15B)
    1.13.11.-  
     247 (ALOX15B)
SSDB
Motif
Pfam: Lipoxygenase PLAT DNA_pol3_tau_4
Other DBs
NCBI-GeneID: 247
NCBI-ProteinID: NP_001132
OMIM: 603697
HGNC: 434
Ensembl: ENSG00000179593
Vega: OTTHUMG00000108181
Pharos: O15296(Tchem)
UniProt: O15296
LinkDB
Structure
PDB: 
4NRE

Position
17p13.1
AA seq 676 aa
MAEFRVRVSTGEAFGAGTWDKVSVSIVGTRGESPPLPLDNLGKEFTAGAEEDFQVTLPED
VGRVLLLRVHKAPPVLPLLGPLAPDAWFCRWFQLTPPRGGHLLFPCYQWLEGAGTLVLQE
GTAKVSWADHHPVLQQQRQEELQARQEMYQWKAYNPGWPHCLDEKTVEDLELNIKYSTAK
NANFYLQAGSAFAEMKIKGLLDRKGLWRSLNEMKRIFNFRRTPAAEHAFEHWQEDAFFAS
QFLNGLNPVLIRRCHYLPKNFPVTDAMVASVLGPGTSLQAELEKGSLFLVDHGILSGIQT
NVINGKPQFSAAPMTLLYQSPGCGPLLPLAIQLSQTPGPNSPIFLPTDDKWDWLLAKTWV
RNAEFSFHEALTHLLHSHLLPEVFTLATLRQLPHCHPLFKLLIPHTRYTLHINTLARELL
IVPGQVVDRSTGIGIEGFSELIQRNMKQLNYSLLCLPEDIRTRGVEDIPGYYYRDDGMQI
WGAVERFVSEIIGIYYPSDESVQDDRELQAWVREIFSKGFLNQESSGIPSSLETREALVQ
YVTMVIFTCSAKHAAVSAGQFDSCAWMPNLPPSMQLPPPTSKGLATCEGFIATLPPVNAT
CDVILALWLLSKEPGDQRPLGTYPDEHFTEEAPRRSIATFQSRLAQISRGIQERNQGLVL
PYTYLDPPLIENSVSI
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggccgagttcagggtcagggtgtccaccggagaagccttcggggctggcacatgggac
aaagtgtctgtcagcatcgtggggacccggggagagagccccccactgcccctggacaat
ctcggcaaggagttcactgcgggcgctgaggaggacttccaggtgacgctcccggaggac
gtaggccgagtgctgctgctgcgcgtgcacaaggcgcccccagtgctgcccctgctgggg
cccctggccccggatgcctggttctgccgctggttccagctgacaccgccgcggggcggc
cacctcctcttcccctgctaccagtggctggagggggcggggaccctggtgctgcaggag
ggtacagccaaggtgtcctgggcagaccaccaccctgtgctccagcaacagcgccaggag
gagcttcaggcccggcaggagatgtaccagtggaaggcttacaacccaggttggcctcac
tgcctggatgaaaagacagtggaagacttggagctcaatatcaaatactccacagccaag
aatgccaacttttatctacaggctggctctgcttttgcagagatgaaaatcaaggggttg
ctggaccgcaaggggctctggaggagtctgaatgagatgaaaaggatcttcaacttccgg
aggaccccagcagctgagcacgcatttgagcactggcaggaggacgccttcttcgcctcc
cagttcctgaatggtctcaaccctgtcctgatccgccgctgtcactacctcccaaagaac
ttccccgtcactgatgccatggtggcctcagtgttgggtcctgggaccagcttgcaggct
gagctagagaagggctccctgttcttggtggatcacggcatcctctctggcatccagacc
aatgtcattaatgggaagcctcagttctctgcggccccaatgaccctgctataccagagc
ccaggctgcgggccgctgctgcctctcgccatccagctcagccagacccccggcccaaac
agccccatcttcctgcccactgatgacaagtgggactggttgctggccaagacctgggtg
cgcaatgccgagttctccttccatgaggccctcacgcacctgctgcactcacatctgctg
cctgaggtcttcaccctggctaccctgcgtcagctgccccactgccaccctctcttcaag
ctgctgatcccgcacacccgatacaccctgcacatcaacacactcgcccgggagctgctt
atcgtgccagggcaggtggtggacaggtccacaggcatcggcattgaaggcttctctgag
ttgatacagaggaacatgaagcagctgaactattctctcctgtgtctgcctgaggatatc
cggacccgaggagttgaagacatcccaggctactactaccgtgatgatgggatgcagatc
tggggtgcagtggaacgctttgtctctgaaatcatcggtatctactacccaagtgatgag
tctgtccaagatgacagagagctccaggcctgggtcagagagatcttctccaagggcttc
ctaaaccaggagagctcaggtataccctcctcactggagacccgggaagccctggtgcag
tatgtcaccatggtgatattcacctgctccgccaagcatgcggctgtcagtgcagggcag
tttgactcctgtgcttggatgcccaacctgccacccagcatgcagctgccaccacccacc
tccaaaggcctggcaacatgcgagggcttcatagccaccctcccacctgtcaatgccaca
tgtgatgtcatccttgctctctggttgctgagcaaggagcctggagaccaaaggcccctg
ggcacctatccggatgagcacttcacagaggaggcccctcggcggagcatcgccaccttc
cagagccgcctggcccagatctcgaggggcatccaggagcggaaccagggcctggtgctg
ccctacacctacctagaccctcccctcatcgagaacagcgtctccatctaa

DBGET integrated database retrieval system