KEGG   Homo sapiens (human): 2488Help
Entry
2488              CDS       T01001                                 

Gene name
FSHB, HH24
Definition
(RefSeq) follicle stimulating hormone subunit beta
  KO
K05250  follitropin subunit beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
hsa04912  GnRH signaling pathway
hsa04913  Ovarian steroidogenesis
Disease
H01253  Isolated follicle-stimulating hormone deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    2488 (FSHB)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    2488 (FSHB)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    2488 (FSHB)
   04913 Ovarian steroidogenesis
    2488 (FSHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cys_knot
Motif
Other DBs
NCBI-GeneID: 2488
NCBI-ProteinID: NP_000501
OMIM: 136530
HGNC: 3964
Ensembl: ENSG00000131808
Vega: OTTHUMG00000166146
Pharos: P01225(Tbio)
CPD: C18184
UniProt: P01225 A0A0F7RQE8
LinkDB All DBs
Structure
PDB: 

Position
11p14.1
AA seq 129 aa AA seqDB search
MKTLQFFFLFCCWKAICCNSCELTNITIAIEKEECRFCISINTTWCAGYCYTRDLVYKDP
ARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGKCDSDSTDCTVRGLGPS
YCSFGEMKE
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgaagacactccagtttttcttccttttctgttgctggaaagcaatctgctgcaatagc
tgtgagctgaccaacatcaccattgcaatagagaaagaagaatgtcgtttctgcataagc
atcaacaccacttggtgtgctggctactgctacaccagggatctggtgtataaggaccca
gccaggcccaaaatccagaaaacatgtaccttcaaggaactggtatacgaaacagtgaga
gtgcccggctgtgctcaccatgcagattccttgtatacatacccagtggccacccagtgt
cactgtggcaagtgtgacagcgacagcactgattgtactgtgcgaggcctggggcccagc
tactgctcctttggtgaaatgaaagaataa

DBGET integrated database retrieval system