KEGG   Homo sapiens (human): 2520
Entry
2520              CDS       T01001                                 

Gene name
GAST, GAS
Definition
(RefSeq) gastrin
  KO
K13768  gastrin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04971  Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09154 Digestive system
   04971 Gastric acid secretion
    2520 (GAST)
SSDB
Motif
Pfam: Gastrin
Other DBs
NCBI-GeneID: 2520
NCBI-ProteinID: NP_000796
OMIM: 137250
HGNC: 4164
Ensembl: ENSG00000184502
Vega: OTTHUMG00000133496
Pharos: P01350(Tbio)
CPD: C16113 C18186 C18187
UniProt: P01350 A0A0E3VY36
LinkDB
Position
17q21.2
AA seq 101 aa
MQRLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRDLELPWLEQQGPASHHRRQL
GPQGPPHLVADPSKKQGPWLEEEEEAYGWMDFGRRSAEDEN
NT seq 306 nt   +upstreamnt  +downstreamnt
atgcagcgactgtgtgtgtatgtgctgatctttgcactggctctggccgccttctctgaa
gcttcttggaagccccgctcccagcagccagatgcacccttaggtacaggggccaacagg
gacctggagctaccctggctggagcagcagggcccagcctctcatcatcgaaggcagctg
ggaccccagggtcccccacacctcgtggcagacccgtccaagaagcagggaccatggctg
gaggaagaagaagaagcctatggatggatggacttcggccgccgcagtgctgaggatgag
aactaa

DBGET integrated database retrieval system