KEGG   Homo sapiens (human): 2529
Entry
2529              CDS       T01001                                 

Gene name
FUT7, FucT-VII
Definition
(RefSeq) fucosyltransferase 7
  KO
K07635  galactoside alpha-1,3-fucosyltransferase 7 [EC:2.4.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00601  Glycosphingolipid biosynthesis - lacto and neolacto series
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    2529 (FUT7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    2529 (FUT7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     2529 (FUT7)
Glycosyltransferases [BR:hsa01003]
 Glycan extension
  Lewis blood group
   2529 (FUT7)
SSDB
Motif
Pfam: Glyco_transf_10 Glyco_tran_10_N
Other DBs
NCBI-GeneID: 2529
NCBI-ProteinID: NP_004470
OMIM: 602030
HGNC: 4018
Ensembl: ENSG00000180549
Vega: OTTHUMG00000020964
Pharos: Q11130(Tbio)
UniProt: Q11130
LinkDB
Position
9q34.3
AA seq 342 aa
MNNAGHGPTRRLRGLGVLAGVALLAALWLLWLLGSAPRGTPAPQPTITILVWHWPFTDQP
PELPSDTCTRYGIARCHLSANRSLLASADAVVFHHRELQTRRSHLPLAQRPRGQPWVWAS
MESPSHTHGLSHLRGIFNWVLSYRRDSDIFVPYGRLEPHWGPSPPLPAKSRVAAWVVSNF
QERQLRARLYRQLAPHLRVDVFGRANGRPLCASCLVPTVAQYRFYLSFENSQHRDYITEK
FWRNALVAGTVPVVLGPPRATYEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFA
WRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
NT seq 1029 nt   +upstreamnt  +downstreamnt
atgaataatgctgggcacggccccacccggaggctgcgaggcttgggggtcctggccggg
gtggctctgctcgctgccctctggctcctgtggctgctggggtcagcccctcggggtacc
ccggcaccccagcccacgatcaccatccttgtctggcactggcccttcactgaccagccc
ccagagctgcccagcgacacctgcacccgctacggcatcgcccgctgccacctgagtgcc
aaccgaagcctgctggccagcgccgacgccgtggtcttccaccaccgcgagctgcagacc
cggcggtcccacctgcccctggcccagcggccgcgagggcagccctgggtgtgggcctcc
atggagtctcctagccacacccacggcctcagccacctccgaggcatcttcaactgggtg
ctgagctaccggcgcgactcggacatctttgtgccctatggccgcctggagccccactgg
gggccctcgccaccgctgccagccaagagcagggtggccgcctgggtggtcagcaacttc
caggagcggcagctgcgtgccaggctgtaccggcagctggcgcctcatctgcgggtggat
gtctttggccgtgccaatggacggccactgtgcgccagctgcctggtgcccaccgtggcc
cagtaccgcttctacctgtcctttgagaactctcagcaccgcgactacattacggagaaa
ttctggcgcaacgcactggtggctggcactgtgccagtggtgctggggcccccacgggcc
acctatgaggccttcgtgccggctgacgccttcgtgcatgtggatgactttggctcagcc
cgagagctggcggctttcctcactggcatgaatgagagccgataccaacgcttctttgcc
tggcgtgacaggctccgcgtgcgactgttcaccgactggcgggaacgtttctgtgccatc
tgtgaccgctacccacacctaccccgcagccaagtctatgaggaccttgagggttggttt
caggcctga

DBGET integrated database retrieval system