KEGG   Homo sapiens (human): 2533Help
Entry
2533              CDS       T01001                                 

Gene name
FYB1, ADAP, FYB, PRO0823, SLAP-130, SLAP130, THC3
Definition
(RefSeq) FYN binding protein 1
  KO
K17698  FYN binding protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04015  Rap1 signaling pathway
hsa05135  Yersinia infection
Disease
H00978  Thrombocytopenia (THC)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    2533 (FYB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    2533 (FYB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: hSH3 SH3_2 SH3_1 DUF4651 SH3_3 YL1
Motif
Other DBs
NCBI-GeneID: 2533
NCBI-ProteinID: NP_955367
OMIM: 602731
HGNC: 4036
Ensembl: ENSG00000082074
Vega: OTTHUMG00000162071
Pharos: O15117(Tbio)
UniProt: O15117
LinkDB All DBs
Structure
PDB: 

Position
5p13.1
AA seq 783 aa AA seqDB search
MAKYNTGGNPTEDVSVNSRPFRVTGPNSSSGIQARKNLFNNQGNASPPAGPSNVPKFGSP
KPPVAVKPSSEEKPDKEPKPPFLKPTGAGQRFGTPASLTTRDPEAKVGFLKPVGPKPINL
PKEDSKPTFPWPPGNKPSLHSVNQDHDLKPLGPKSGPTPPTSENEQKQAFPKLTGVKGKF
MSASQDLEPKPLFPKPAFGQKPPLSTENSHEDESPMKNVSSSKGSPAPLGVRSKSGPLKP
AREDSENKDHAGEISSLPFPGVVLKPAASRGGPGLSKNGEEKKEDRKIDAAKNTFQSKIN
QEELASGTPPARFPKAPSKLTVGGPWGQSQEKEKGDKNSATPKQKPLPPLFTLGPPPPKP
NRPPNVDLTKFHKTSSGNSTSKGQTSYSTTSLPPPPPSHPASQPPLPASHPSQPPVPSLP
PRNIKPPFDLKSPVNEDNQDGVTHSDGAGNLDEEQDSEGETYEDIEASKEREKKREKEEK
KRLELEKKEQKEKEKKEQEIKKKFKLTGPIQVIHLAKACCDVKGGKNELSFKQGEQIEII
RITDNPEGKWLGRTARGSYGYIKTTAVEIDYDSLKLKKDSLGAPSRPIEDDQEVYDDVAE
QDDISSHSQSGSGGIFPPPPDDDIYDGIEEEDADDGFPAPPKQLDMGDEVYDDVDTSDFP
VSSAEMSQGTNVGKAKTEEKDLKKLKKQEKEEKDFRKKFKYDGEIRVLYSTKVTTSITSK
KWGTRDLQVKPGESLEVIQTTDDTKVLCRNEEGKYGYVLRSYLADNDGEIYDDIADGCIY
DND
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatataacacggggggcaacccgacagaggatgtctcagtcaatagccgaccc
ttcagagtcacagggccaaactcatcttcaggaatacaagcaagaaagaacttattcaac
aaccaaggaaatgccagccctcctgcaggacccagcaatgtacctaagtttgggtcccca
aagccacctgtggcagtcaaaccttcttctgaggaaaagcctgacaaggaacccaagccc
ccgtttctaaagcccactggagcaggccaaagattcggaacaccagccagcttgaccacc
agagaccccgaggcgaaagtgggatttctgaaacctgtaggccccaagcccatcaacttg
cccaaagaagattccaaacctacatttccctggcctcctggaaacaagccatctcttcac
agtgtaaaccaagaccatgacttaaagccactaggcccgaaatctgggcctactcctcca
acctcagaaaatgaacagaagcaagcgtttcccaaattgactggggttaaagggaaattt
atgtcagcatcacaagatcttgaacccaagcccctcttccccaaacccgcctttggccag
aagccgcccctaagtaccgagaactcccatgaagacgaaagccccatgaagaatgtgtct
tcatcaaaagggtccccagctcccctgggagtcaggtccaaaagcggccctttaaaacca
gcaagggaagactcagaaaataaagaccatgcaggggagatttcaagtttgccctttcct
ggagtggttttgaaacctgctgcgagcaggggaggcccaggtctctccaaaaatggtgaa
gaaaaaaaggaagataggaagatagatgctgctaagaacaccttccagagcaaaataaat
caggaagagttggcctcagggactcctcctgccaggttccctaaggccccttctaagctg
acagtgggggggccatggggccaaagtcaggaaaaggaaaagggagacaagaattcagcc
accccgaaacagaagccattgcctcccttgtttaccttgggtccacctccaccaaaaccc
aacagaccaccaaatgttgacctgacgaaattccacaaaacctcttctggaaacagtact
agcaaaggccagacgtcttactcaacaacttccctgccaccacctccaccatcccatccg
gccagccaaccaccattgccagcatctcacccatcacaaccaccagtcccaagcctacct
cccagaaacattaaacctccgtttgacctaaaaagccctgtcaatgaagacaatcaagat
ggtgtcacgcactctgatggtgctggaaatctagatgaggaacaagacagtgaaggagaa
acatatgaagacatagaagcatccaaagaaagagagaagaaaagggaaaaggaagaaaag
aagaggttagagctggagaaaaaggaacagaaagagaaagaaaagaaagaacaagaaata
aagaagaaatttaaactaacaggccctattcaagtcatccatcttgcaaaagcttgttgt
gatgtcaaaggaggaaagaatgaactgagcttcaagcaaggagagcaaattgaaatcatc
cgcatcacagacaacccagaaggaaaatggttgggcagaacagcaaggggttcatatggc
tatattaaaacaactgctgtagagattgactatgattctttgaaactgaaaaaagactct
cttggtgccccttcaagacctattgaagatgaccaagaagtatatgatgatgttgcagag
caggatgatattagcagccacagtcagagtggaagtggagggatattccctccaccacca
gatgatgacatttatgatgggattgaagaggaagatgctgatgatggtttccctgctcct
cctaaacaattggacatgggagatgaagtttacgatgatgtggatacctctgatttccct
gtttcatcagcagagatgagtcaaggaactaatgttggaaaagctaagacagaagaaaag
gaccttaagaagctaaaaaagcaggaaaaagaagaaaaagacttcaggaaaaaatttaaa
tatgatggtgaaattagagtcctatattcaactaaagttacaacttccataacttctaaa
aagtggggaaccagagatctacaggtaaaacctggtgaatctctagaagttatacaaacc
acagatgacacaaaagttctctgcagaaatgaagaagggaaatatggttatgtccttcgg
agttacctagcggacaatgatggagagatctatgatgatattgctgatggctgcatctat
gacaatgactag

DBGET integrated database retrieval system