KEGG   Homo sapiens (human): 2534Help
Entry
2534              CDS       T01001                                 

Gene name
FYN, SLK, SYN, p59-FYN
Definition
(RefSeq) FYN proto-oncogene, Src family tyrosine kinase
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04611  Platelet activation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04725  Cholinergic synapse
hsa05020  Prion diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05162  Measles
hsa05416  Viral myocarditis
Drug target
Dasatinib (DG00714): D03658 D06414
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04072 Phospholipase D signaling pathway
    2534 (FYN)
   04071 Sphingolipid signaling pathway
    2534 (FYN)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    2534 (FYN)
   04520 Adherens junction
    2534 (FYN)
 Organismal Systems
  Immune system
   04611 Platelet activation
    2534 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    2534 (FYN)
   04660 T cell receptor signaling pathway
    2534 (FYN)
   04664 Fc epsilon RI signaling pathway
    2534 (FYN)
  Nervous system
   04725 Cholinergic synapse
    2534 (FYN)
  Development
   04360 Axon guidance
    2534 (FYN)
   04380 Osteoclast differentiation
    2534 (FYN)
 Human Diseases
  Neurodegenerative diseases
   05020 Prion diseases
    2534 (FYN)
  Cardiovascular diseases
   05416 Viral myocarditis
    2534 (FYN)
  Infectious diseases
   05130 Pathogenic Escherichia coli infection
    2534 (FYN)
   05162 Measles
    2534 (FYN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2534 (FYN)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   2534 (FYN)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    2534 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    2534 (FYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_3
Motif
Other DBs
NCBI-GeneID: 2534
NCBI-ProteinID: NP_002028
OMIM: 137025
HGNC: 4037
Ensembl: ENSG00000010810
Vega: OTTHUMG00000016305
Pharos: P06241(Tclin)
UniProt: P06241
LinkDB All DBs
Structure
PDB: 

Position
6q21
AA seq 537 aa AA seqDB search
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggtgtgacctccatccccaactacaacaacttccacgcagccgggggccaagga
ctcaccgtctttggaggtgtgaactcttcgtctcatacggggaccttgcgtacgagagga
ggaacaggagtgacactctttgtggccctttatgactatgaagcacggacagaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaactggagagacaggttacattcccagcaattatgtggctcca
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagctattgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttctatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggtggatactacattaccacccgggcccag
tttgaaacacttcagcagcttgtacaacattactcagagagagctgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccaggcacaatgtcccccgaatcattccttgaggaagcgcagatcatgaagaag
ctgaagcacgacaagctggtccagctctatgcagtggtgtctgaggagcccatctacatc
gtcaccgagtatatgaacaaaggaagtttactggatttcttaaaagatggagaaggaaga
gctctgaaattaccaaatcttgtggacatggcagcacaggtggctgcaggaatggcttac
atcgagcgcatgaattatatccatagagatctgcgatcagcaaacattctagtggggaat
ggactcatatgcaagattgctgacttcggattggcccgattgatagaagacaatgagtac
acagcaagacaaggtgcaaagttccccatcaagtggacggcccccgaggcagccctgtac
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgaggctacaggatgccctgcccgcaggactgccccatctctctgcatgagctcatgatc
cactgctggaaaaaggaccctgaagaacgccccacttttgagtacttgcagagcttcctg
gaagactactttaccgcgacagagccccagtaccaacctggtgaaaacctgtaa

DBGET integrated database retrieval system