KEGG   Homo sapiens (human): 2534Help
Entry
2534              CDS       T01001                                 

Gene name
FYN, SLK, SYN, p59-FYN
Definition
(RefSeq) FYN proto-oncogene, Src family tyrosine kinase
  KO
K05703  tyrosine-protein kinase Fyn [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04071  Sphingolipid signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04360  Axon guidance
hsa04380  Osteoclast differentiation
hsa04510  Focal adhesion
hsa04520  Adherens junction
hsa04611  Platelet activation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04660  T cell receptor signaling pathway
hsa04664  Fc epsilon RI signaling pathway
hsa04725  Cholinergic synapse
hsa05020  Prion diseases
hsa05130  Pathogenic Escherichia coli infection
hsa05416  Viral myocarditis
Drug target
Dasatinib (DG00714): D03658 D06414
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    2534 (FYN)
   04071 Sphingolipid signaling pathway
    2534 (FYN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    2534 (FYN)
   04520 Adherens junction
    2534 (FYN)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    2534 (FYN)
   04650 Natural killer cell mediated cytotoxicity
    2534 (FYN)
   04660 T cell receptor signaling pathway
    2534 (FYN)
   04664 Fc epsilon RI signaling pathway
    2534 (FYN)
  09156 Nervous system
   04725 Cholinergic synapse
    2534 (FYN)
  09158 Development
   04360 Axon guidance
    2534 (FYN)
   04380 Osteoclast differentiation
    2534 (FYN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion diseases
    2534 (FYN)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    2534 (FYN)
  09171 Infectious disease: bacterial
   05130 Pathogenic Escherichia coli infection
    2534 (FYN)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    2534 (FYN)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    2534 (FYN)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     2534 (FYN)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   2534 (FYN)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    2534 (FYN)
 Endocytosis
  Lipid raft mediated endocytosis
   Flotillin-dependent endocytosis
    2534 (FYN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 SH3_10 Haspin_kinase SH3_3 zf-RING_14
Motif
Other DBs
NCBI-GeneID: 2534
NCBI-ProteinID: NP_002028
OMIM: 137025
HGNC: 4037
Ensembl: ENSG00000010810
Vega: OTTHUMG00000016305
Pharos: P06241(Tclin)
UniProt: P06241
LinkDB All DBs
Structure
PDB: 

Position
6q21
AA seq 537 aa AA seqDB search
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQG
LTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWW
EARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESET
TKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCC
RLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKT
LKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGR
ALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEY
TARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVE
RGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtgtgcaatgtaaggataaagaagcaacaaaactgacggaggagagggacggc
agcctgaaccagagctctgggtaccgctatggcacagaccccacccctcagcactacccc
agcttcggtgtgacctccatccccaactacaacaacttccacgcagccgggggccaagga
ctcaccgtctttggaggtgtgaactcttcgtctcatacggggaccttgcgtacgagagga
ggaacaggagtgacactctttgtggccctttatgactatgaagcacggacagaagatgac
ctgagttttcacaaaggagaaaaatttcaaatattgaacagctcggaaggagattggtgg
gaagcccgctccttgacaactggagagacaggttacattcccagcaattatgtggctcca
gttgactctatccaggcagaagagtggtactttggaaaacttggccgaaaagatgctgag
cgacagctattgtcctttggaaacccaagaggtacctttcttatccgcgagagtgaaacc
accaaaggtgcctattcactttctatccgtgattgggatgatatgaaaggagaccatgtc
aaacattataaaattcgcaaacttgacaatggtggatactacattaccacccgggcccag
tttgaaacacttcagcagcttgtacaacattactcagagagagctgcaggtctctgctgc
cgcctagtagttccctgtcacaaagggatgccaaggcttaccgatctgtctgtcaaaacc
aaagatgtctgggaaatccctcgagaatccctgcagttgatcaagagactgggaaatggg
cagtttggggaagtatggatgggtacctggaatggaaacacaaaagtagccataaagact
cttaaaccaggcacaatgtcccccgaatcattccttgaggaagcgcagatcatgaagaag
ctgaagcacgacaagctggtccagctctatgcagtggtgtctgaggagcccatctacatc
gtcaccgagtatatgaacaaaggaagtttactggatttcttaaaagatggagaaggaaga
gctctgaaattaccaaatcttgtggacatggcagcacaggtggctgcaggaatggcttac
atcgagcgcatgaattatatccatagagatctgcgatcagcaaacattctagtggggaat
ggactcatatgcaagattgctgacttcggattggcccgattgatagaagacaatgagtac
acagcaagacaaggtgcaaagttccccatcaagtggacggcccccgaggcagccctgtac
gggaggttcacaatcaagtctgacgtgtggtcttttggaatcttactcacagagctggtc
accaaaggaagagtgccatacccaggcatgaacaaccgggaggtgctggagcaggtggag
cgaggctacaggatgccctgcccgcaggactgccccatctctctgcatgagctcatgatc
cactgctggaaaaaggaccctgaagaacgccccacttttgagtacttgcagagcttcctg
gaagactactttaccgcgacagagccccagtaccaacctggtgaaaacctgtaa

KEGG   Homo sapiens (human): 3932Help
Entry
3932              CDS       T01001                                 

Gene name
LCK, IMD22, LSK, YT16, p56lck, pp58lck
Definition
(RefSeq) LCK proto-oncogene, Src family tyrosine kinase
  KO
K05856  lymphocyte cell-specific protein tyrosine kinase [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04380  Osteoclast differentiation
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05135  Yersinia infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05340  Primary immunodeficiency
Network
nt06160  Human T-cell leukemia virus 1 (HTLV-1)
  Element
N00511  HTLV-1 Tax to E47-mediated transcription
Disease
H00093  Combined immunodeficiency
Drug target
Dasatinib (DG00714): D03658 D06414
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    3932 (LCK)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    3932 (LCK)
   04660 T cell receptor signaling pathway
    3932 (LCK)
   04658 Th1 and Th2 cell differentiation
    3932 (LCK)
   04659 Th17 cell differentiation
    3932 (LCK)
  09158 Development
   04380 Osteoclast differentiation
    3932 (LCK)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    3932 (LCK)
  09163 Immune disease
   05340 Primary immunodeficiency
    3932 (LCK)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    3932 (LCK)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    3932 (LCK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    3932 (LCK)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    3932 (LCK)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     3932 (LCK)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   3932 (LCK)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    3932 (LCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_2 SH3_9 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 3932
NCBI-ProteinID: NP_001036236
OMIM: 153390
HGNC: 6524
Ensembl: ENSG00000182866
Vega: OTTHUMG00000007463
Pharos: P06239(Tclin)
UniProt: P06239 A0A0S2Z3Y8
LinkDB All DBs
Structure
PDB: 

Position
1p35.2
AA seq 509 aa AA seqDB search
MGCGCSSHPEDDWMENIDVCENCHYPIVPLDGKGTLLIRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQSGEWWKAQSLTTGQEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDNGGFYISPRITFPGLHELVRHYTNASDGLCTRLSRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTPSGIKLTINKLLDMAAQIAEGMAFIEERNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNPEVIQNLERGYRMVRPDNCPEELYQLMRLCWKER
PEDRPTFDYLRSVLEDFFTATEGQYQPQP
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgggctgtggctgcagctcacacccggaagatgactggatggaaaacatcgatgtgtgt
gagaactgccattatcccatagtcccactggatggcaagggcacgctgctcatccgaaat
ggctctgaggtgcgggacccactggttacctacgaaggctccaatccgccggcttcccca
ctgcaagacaacctggttatcgctctgcacagctatgagccctctcacgacggagatctg
ggctttgagaagggggaacagctccgcatcctggagcagagcggcgagtggtggaaggcg
cagtccctgaccacgggccaggaaggcttcatccccttcaattttgtggccaaagcgaac
agcctggagcccgaaccctggttcttcaagaacctgagccgcaaggacgcggagcggcag
ctcctggcgcccgggaacactcacggctccttcctcatccgggagagcgagagcaccgcg
ggatcgttttcactgtcggtccgggacttcgaccagaaccagggagaggtggtgaaacat
tacaagatccgtaatctggacaacggtggcttctacatctcccctcgaatcacttttccc
ggcctgcatgaactggtccgccattacaccaatgcttcagatgggctgtgcacacggttg
agccgcccctgccagacccagaagccccagaagccgtggtgggaggacgagtgggaggtt
cccagggagacgctgaagctggtggagcggctgggggctggacagttcggggaggtgtgg
atggggtactacaacgggcacacgaaggtggcggtgaagagcctgaagcagggcagcatg
tccccggacgccttcctggccgaggccaacctcatgaagcagctgcaacaccagcggctg
gttcggctctacgctgtggtcacccaggagcccatctacatcatcactgaatacatggag
aatgggagtctagtggattttctcaagaccccttcaggcatcaagttgaccatcaacaaa
ctcctggacatggcagcccaaattgcagaaggcatggcattcattgaagagcggaattat
attcatcgtgaccttcgggctgccaacattctggtgtctgacaccctgagctgcaagatt
gcagactttggcctagcacgcctcattgaggacaacgagtacacagccagggagggggcc
aagtttcccattaagtggacagcgccagaagccattaactacgggacattcaccatcaag
tcagatgtgtggtcttttgggatcctgctgacggaaattgtcacccacggccgcatccct
tacccagggatgaccaacccggaggtgattcagaacctggagcgaggctaccgcatggtg
cgccctgacaactgtccagaggagctgtaccaactcatgaggctgtgctggaaggagcgc
ccagaggaccggcccacctttgactacctgcgcagtgtgctggaggacttcttcacggcc
acagagggccagtaccagcctcagccttga

DBGET integrated database retrieval system